DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11149 and CG3253

DIOPT Version :9

Sequence 1:NP_608952.2 Gene:CG11149 / 33800 FlyBaseID:FBgn0031732 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001246488.1 Gene:CG3253 / 37861 FlyBaseID:FBgn0041706 Length:389 Species:Drosophila melanogaster


Alignment Length:422 Identity:104/422 - (24%)
Similarity:172/422 - (40%) Gaps:81/422 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 SLRFE--RLQHGEFW---LLQNL----VMGRKSREVGCAESVTYTTNGDFTFFDNLEMVVSRWRA 154
            ||.|:  .|.:|. |   ||..:    ::|.:..:......|...|.......::|..|.:.|:.
  Fly    12 SLAFDNINLSYGR-WDNQLLYRIKDFALLGEQYVDSSEGSLVCLATQTSVERLNSLPQVAANWQG 75

  Fly   155 PVSFAIHTPGYDLNTTLD-AIRYVRNCLPESDSIKDWVSFHVYFPNQHMPEYVPYDE-AEVLMYP 217
            .:|.|:...|.:....|. .:.|:|.|..   :|::..:||:..|..       :|: ..|...|
  Fly    76 KMSVALFAAGPEEFVVLQYFVTYMRLCFA---NIRENATFHLLTPRD-------FDKLPRVAALP 130

  Fly   218 -HM-----CTLANGSLVSPLYTQIPTTDSYKSRANLTYPINVGRNIARLATNTHFIFACDIELYP 276
             :|     |...:.:|.:.|..:...|..::.|.  |||.|..||:||....|.::|..||::.|
  Fly   131 LNMRGKFDCQYPDRTLKALLKFRSLKTLQWRQRN--TYPQNHMRNLARKGCQTKYVFLTDIDIVP 193

  Fly   277 SVGFVDQFLDMVARNHSVLALDPRQRRRVYPLPVFEIETGAKVPVDKDELLALYRKQQAQVFHLK 341
            |...|.|.      ||.....: ..:...|.:|.|||:..|..|..|:.|:.|.||..|:.||.|
  Fly   194 STNSVPQL------NHFFRTAN-CTKSCAYVIPTFEIDVRATFPRSKNALVRLIRKGLARPFHEK 251

  Fly   342 LCPTCHTIPGQEEWL----NRTSRADDHLHVFSKALRKWKFRAWEPFYVSDNTEPLFDERVTWEG 402
            :...........:||    |.|..:..|:      :..::| .:||||::.:..|..|||....|
  Fly   252 VFIYNQYATNFSKWLSPNTNETEVSVSHV------VTNFEF-LYEPFYIAVDNAPAHDERFLGYG 309

  Fly   403 QSNKRIQVSYYCSQVSVSQCNLLLQNYAMCLLDYEYHVLSPAFLVHSPGIKQSSKADSTRLQ--- 464
            .:..        |||           |.|.:..|:::||||.|..|. |:::.....:.|.|   
  Fly   310 FTRN--------SQV-----------YEMHIAGYQFYVLSPVFTGHW-GLQRKQARPAWREQQNN 354

  Fly   465 --------YAKEMTKFIKNKIEPEYRVLFGKN 488
                    :..|:  |::.|.:|...:...||
  Fly   355 ANRRKFDVFKSEI--FVRYKNDPRLLLKAKKN 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11149NP_608952.2 Glyco_transf_49 130..485 CDD:290607 93/377 (25%)
CG3253NP_001246488.1 Glyco_transf_49 52..371 CDD:290607 91/366 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D485184at33208
OrthoFinder 1 1.000 - - FOG0003642
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.