DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11149 and Large1

DIOPT Version :9

Sequence 1:NP_608952.2 Gene:CG11149 / 33800 FlyBaseID:FBgn0031732 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001101909.1 Gene:Large1 / 361368 RGDID:1308895 Length:385 Species:Rattus norvegicus


Alignment Length:310 Identity:60/310 - (19%)
Similarity:99/310 - (31%) Gaps:92/310 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LVWRNLQQAQKLAASSNTGGQKSVGLLLSNESNPSRFSANFHLANDQHPKIIRREDSARTKELRS 91
            |.|..|     .|.|...|...|:..|.|...:| |::|:.....:.....:|..:.......|.
  Rat    24 LTWIYL-----FAGSLEDGKPVSLSPLESQAHSP-RYTASSQRERESLEVRVREVEEENRALRRQ 82

  Fly    92 LLKCRDRSLRFERLQHGEFWLLQ-----------NLVMGRKSREVGCAESVTYTTNGDFTFFDNL 145
            |...:.:|....|..|.:.:.::           .:|.|..| |.|...:|           :..
  Rat    83 LSLAQGQSPAHRRGNHSKTYSMEEGTGDSENQRAGIVAGNSS-ECGQQPAV-----------EKC 135

  Fly   146 EMVVSRWRAPVSFAIHTPGYDLNTTLDAIRYVRNCLPESDSIKDWVSFHVYFPNQHMPEYVPYDE 210
            |        .:..||...||  |.:.|.:..|::.|...   ::.:.||:.              
  Rat   136 E--------TIHVAIVCAGY--NASRDVVTLVKSVLFHR---RNPLHFHLI-------------- 173

  Fly   211 AEVLMYPHMCTLANGSLVSPLYTQIPTTDSYKSRAN-------------------LTYPINVGRN 256
            |:.:....:.||....:|..:.......|..||..:                   .|.|.|:.|.
  Rat   174 ADSIAEQILATLFQTWMVPAVRVDFYNADELKSEVSWIPNKHYSGIYGLMKLVLTKTLPANLERV 238

  Fly   257 IARLATNTHFIFACDI-ELY---------PSVGFV----DQFLDMVARNH 292
            |   ..:|...||.|| ||:         ..:|.|    |.:|..:.:||
  Rat   239 I---VLDTDITFATDIAELWAVFHKFKGQQVLGLVENQSDWYLGNLWKNH 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11149NP_608952.2 Glyco_transf_49 130..485 CDD:290607 37/196 (19%)
Large1NP_001101909.1 RfaJ 136..>359 CDD:224359 36/180 (20%)
GT8_LARGE_C 138..377 CDD:133053 35/170 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339848
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D729091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.