DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11149 and bgnt-1.5

DIOPT Version :9

Sequence 1:NP_608952.2 Gene:CG11149 / 33800 FlyBaseID:FBgn0031732 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001024774.1 Gene:bgnt-1.5 / 3565692 WormBaseID:WBGene00010694 Length:403 Species:Caenorhabditis elegans


Alignment Length:449 Identity:99/449 - (22%)
Similarity:156/449 - (34%) Gaps:118/449 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 NFHLAN--DQHPKIIRREDSARTKELRSLLKCRDRSLRFERLQHGEFWLLQNLVMGRKS-REVGC 127
            |::|..  |:|.||........|:                 :|:.|:.:..|.:..... ||.| 
 Worm    30 NYNLKTIFDKHGKISLENGFIDTE-----------------MQNDEYCVGYNFLEATNMFREDG- 76

  Fly   128 AESVTYTTNGDFTFFDNLEMVVSRWRAPVSFAIHTPGYDLNTTLDAIRYVRNCLPESDSIKDWVS 192
            .|.||...:|.......:|.....|..|:||.:.. .:.....|:.|..|..|   .:..::.|:
 Worm    77 LEPVTLAVHGTSEMMKAIEKKPLNWDGPISFGLFI-DFHSRQVLEYISEVHRC---DEKFREKVT 137

  Fly   193 FHVYFPNQHMPEYVPYDEAEVLMYPHMCTLANGSLVSPLYTQ----IPTTDSYKSRAN---LTYP 250
            .|..|              .:..:...|....   :||...:    :...|.|:..|.   ..||
 Worm   138 VHFAF--------------RLSAFQGSCPQIK---ISPTNRECKEFLHNRDKYRQAAGGPFQLYP 185

  Fly   251 INVGRNIARLATNTHFIFACDIELYPSVGF-------VDQFLDMVARNHSVLALDPRQRRRVYPL 308
            .|:.|||||....:...|..|.::..|.||       .:|.:|..::|..|:       ||    
 Worm   186 SNLMRNIARQGAKSDIHFIADGDMVMSEGFAMKIKPIANQVIDGTSKNLLVV-------RR---- 239

  Fly   309 PVFEI-ETGAKVPVDKDELLALYRKQQAQVFHLKLCPTCHTIPGQEEWLNRTSRADDHLHVFSKA 372
              ||. ||  .:|.|..:|....:.::...||.|...:.|.|.....|...::..|         
 Worm   240 --FETNET--TIPRDHKQLQESIKNKKVFQFHHKFFFSGHKIANISHWFAVSNNTD--------- 291

  Fly   373 LRKWKFRAWEPFYVSDNTEPLFDERVTWEGQ----SNKRIQVSYYCSQVSVSQCNLLLQNYAMCL 433
                :...||..|.|.          .||.|    .|......|:.:::.|.|..:    |::|.
 Worm   292 ----RITTWEIPYSSS----------LWEVQVILHRNDLYNADYFPARIKVMQSLV----YSLCR 338

  Fly   434 LDYEYHVLSPAFLVHSPGIK------------QSSKADSTRL--QYAKEMTKFIKNKIE 478
            .:|.:::||..|.||. |||            .|.|...||.  :|.|||.....|.::
 Worm   339 ANYTFNLLSHVFNVHE-GIKLDDTGFSKSVIAHSKKYGKTRAYNRYVKEMDDAYPNTLK 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11149NP_608952.2 Glyco_transf_49 130..485 CDD:290607 85/382 (22%)
bgnt-1.5NP_001024774.1 Glyco_transf_49 79..391 CDD:290607 84/375 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158827
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49245
OrthoDB 1 1.010 - - D485184at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.720

Return to query results.
Submit another query.