DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11149 and GXYLT1

DIOPT Version :9

Sequence 1:NP_608952.2 Gene:CG11149 / 33800 FlyBaseID:FBgn0031732 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_775872.1 Gene:GXYLT1 / 283464 HGNCID:27482 Length:440 Species:Homo sapiens


Alignment Length:545 Identity:95/545 - (17%)
Similarity:170/545 - (31%) Gaps:197/545 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RKYVRLWPVLILFNVALLLVWRNLQQAQKLAASSNTGGQKSVGLLLS-------------NESNP 60
            |:|:|:..:.:......|| :...|.|..|...:..||.|....:.|             ..:.|
Human     2 RRYLRVVVLCVACGFCSLL-YAFSQLAVSLEEGTGGGGGKPQAAVASWLAGGGRGAVRGAGVAGP 65

  Fly    61 SRFSANFHLANDQHPKIIRREDSARTKELRSLLKCRDRSLRFERLQHGEFWLLQNLVMG------ 119
            :           .||.:..|              |:|.||.:    ...:|:|.:.|.|      
Human    66 A-----------AHPGVSDR--------------CKDFSLCY----WNPYWMLPSDVCGMNCFWE 101

  Fly   120 ---RKSRE-----------VGCAESVTYTTNGDFTFFDNLEMVVSRWRAPVSFAIHTPGYDLNTT 170
               |.|.:           |.|.|              .||..::..::.:.|:|....:.:   
Human   102 AAFRYSLKIQPVEKMHLAVVACGE--------------RLEETMTMLKSAIIFSIKPLQFHI--- 149

  Fly   171 LDAIRYVRNCLPES--DSIKDW--------VSFHVYFPNQHMPEYVPYDEAEVLMYPHMCTLANG 225
                 :..:.|..|  ..:.:|        ..:.:.||:::..|:      :.|..|  |  |:.
Human   150 -----FAEDQLHHSFKGRLDNWSFLQTFNYTLYPITFPSENAAEW------KKLFKP--C--ASQ 199

  Fly   226 SLVSPLYTQIPTTDSYKSRANLTY---------PINVGRNIARLATNTHFIFACDIELYPSVGFV 281
            .|..||.  :...||      |.|         |::...::.:...:|...........|.:|:.
Human   200 RLFLPLI--LKEVDS------LLYVDTDILFLRPVDDIWSLLKKFNSTQIAAMAPEHEEPRIGWY 256

  Fly   282 DQFLDMVAR---------NHSVLALDPRQRRRVY---PLPVFEIETGAKVPVDKDELLALYRKQQ 334
            ::|    ||         |..|:.::..:.||.|   .:....::.|       |.|:.|.:|.:
Human   257 NRF----ARHPYYGKTGVNSGVMLMNMTRMRRKYFKNDMTTVRLQWG-------DILMPLLKKYK 310

  Fly   335 AQVFHLKLCPTCHTIPGQEEWLNRT-SRADDHLHVFSKALRKWKFRAWEPFYVS----------- 387
            ..:..           |.::.||.. ....:.|.||.   .:|.:|.....|.|           
Human   311 LNITW-----------GDQDLLNIVFFHNPESLFVFP---CQWNYRPDHCIYGSNCQEAEEGGIF 361

  Fly   388 ----------DNTEPLFDERVTWEGQSNKRIQVSYYCSQVSVSQCNLLLQNYAMCLLDYEYHVLS 442
                      |:.:|.|  |..:|...|...:.....|.:...:..|....:..|...|:..   
Human   362 ILHGNRGVYHDDKQPAF--RAVYEALRNCSFEDDNIRSLLKPLELELQKTVHTYCGKIYKIF--- 421

  Fly   443 PAFLVHSPGIKQSSKADSTRLQYAK 467
                     |||.:|  |.|.:||:
Human   422 ---------IKQLAK--SVRDRYAR 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11149NP_608952.2 Glyco_transf_49 130..485 CDD:290607 66/391 (17%)
GXYLT1NP_775872.1 GT8_like_2 116..417 CDD:133052 60/367 (16%)
RfaJ <184..>345 CDD:224359 37/203 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146082
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.