DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11149 and Gxylt1

DIOPT Version :9

Sequence 1:NP_608952.2 Gene:CG11149 / 33800 FlyBaseID:FBgn0031732 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001333714.1 Gene:Gxylt1 / 223827 MGIID:2684933 Length:435 Species:Mus musculus


Alignment Length:460 Identity:84/460 - (18%)
Similarity:147/460 - (31%) Gaps:164/460 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 KCRDRSLRFERLQHGEFWLLQNLVMG------------RKSRE--------VGCAESVTYTTNGD 138
            :|::.||.:    ...:|:|.:.|.|            .|:|.        |.|.|         
Mouse    69 RCKEFSLSY----WNPYWMLPSDVCGMNCFWEAAFRYDMKTRPDEKMHLAVVACGE--------- 120

  Fly   139 FTFFDNLEMVVSRWRAPVSFAI---HTPGYDLNTTLDAIRYVRNCLPESDSIKDWVSFHVYFPNQ 200
                 .||..|:..::.:.|:|   |...:..:...|:.:         |.:..| ||...|...
Mouse   121 -----RLEETVTMLKSALIFSIKPLHVHIFAEDQLHDSFK---------DRLASW-SFLRRFDYS 170

  Fly   201 HMPEYVPYDEA---EVLMYPHMCTLANGSLVSPLYTQIPTTDSYKSRANLTY---------PINV 253
            ..|...|.|.|   :.|..|  |  |:..|..||.  :...||      |.|         |::.
Mouse   171 LYPITFPGDSAADWKKLFKP--C--ASQRLFLPLI--LKEVDS------LLYVDTDILFLRPVDD 223

  Fly   254 GRNIARLATNTHFIFACDIELYPSVGFVDQFLDMVAR---------NHSVLALDPRQRRRVY--- 306
            ..::.:...:|...........|.:|:.::|    ||         |..|:.::..:.||.|   
Mouse   224 IWSLLKKFNSTQIAAMAPEHEEPRIGWYNRF----ARHPYYGRTGVNSGVMLMNMTRMRRKYFKN 284

  Fly   307 PLPVFEIETGAKVPVDKDELLALYRKQQAQVFHLKLCPTCHTIPGQEEWLNRT-SRADDHLHVFS 370
            .:....::.|       |.|:.|.:|.:..:..           |.::.||.. |...:.|.||.
Mouse   285 DMTTARLQWG-------DILMPLLKKYKLNITW-----------GDQDLLNIVFSHNPESLFVFP 331

  Fly   371 KALRKWKFRAWEPFYVS---------------------DNTEPLFDERVTWEGQSNKRIQVSYYC 414
               .:|.:|.....|.|                     |:.:|.|  |..:|...|..::.....
Mouse   332 ---CQWNYRPDHCIYGSNCREAEEEGVFILHGNRGVYHDDKQPAF--RAVYEALRNCSLEDDSVR 391

  Fly   415 SQVSVSQCNLLLQNYAMCLLDYEYHVLSPAFLVHSPGIKQSSKADSTRLQYAKEMTKFIKNKIE- 478
            |.:...:..|....:..|...|:.                          :.|::||.|:|:.: 
Mouse   392 SLLKPLELELQKTVHTYCGKTYKI--------------------------FIKQLTKSIRNRYDT 430

  Fly   479 -PEYR 482
             |:.|
Mouse   431 PPKER 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11149NP_608952.2 Glyco_transf_49 130..485 CDD:290607 72/404 (18%)
Gxylt1NP_001333714.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836180
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.