DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11149 and XXYLT1

DIOPT Version :10

Sequence 1:NP_608952.2 Gene:CG11149 / 33800 FlyBaseID:FBgn0031732 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_689744.3 Gene:XXYLT1 / 152002 HGNCID:26639 Length:393 Species:Homo sapiens


Alignment Length:86 Identity:21/86 - (24%)
Similarity:33/86 - (38%) Gaps:12/86 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 KSREVGCAESVTYTTNGDFTFFDNLEMVVSRWRAPVSFAIHTPGYDLNTTL-------DAIRYV- 177
            ||.|.|.|..|.|.....||..::...:.::.|..:...:....::.:..|       :|.|.| 
Human    87 KSLEGGGAGPVDYHLLMMFTKAEHNAALQAKARVALRSLLRLAKFEAHEVLNLHFVSEEASREVA 151

  Fly   178 ----RNCLPESDSIKDWVSFH 194
                |..||.:...|..|.||
Human   152 KGLLRELLPPAAGFKCKVIFH 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11149NP_608952.2 Glyco_transf_49 130..486 CDD:464027 16/77 (21%)
XXYLT1NP_689744.3 Glyco_tranf_GTA_type 120..383 CDD:472172 11/53 (21%)
Interaction with target proteins. /evidence=ECO:0000250|UniProtKB:Q3U4G3 263..266
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.