DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11149 and b4gat1

DIOPT Version :9

Sequence 1:NP_608952.2 Gene:CG11149 / 33800 FlyBaseID:FBgn0031732 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001265757.1 Gene:b4gat1 / 101669768 ZFINID:ZDB-GENE-121001-5 Length:431 Species:Danio rerio


Alignment Length:488 Identity:124/488 - (25%)
Similarity:192/488 - (39%) Gaps:115/488 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LFNVAL--LLVWRNLQ------------QAQKLAASSNTGGQKSVGLLLSNESNPSRFSANFHLA 70
            :|.|.|  ||:...||            :.|:...|...|.:|:..   ..|.||.|....:.|:
Zfish     9 VFKVVLSALLIVALLQLLYLSFLSKLHGKQQRYKYSELFGSKKNAN---QGEKNPRREHLRYSLS 70

  Fly    71 NDQHPKIIRREDSARTKELRSLLKCRDRSLRFERLQHGEFWLLQNLVMGRKSREVGCAESVTYTT 135
            ..   .|.  :.|.:.:..::|:|             .:|...|......:|..:..|   |:||
Zfish    71 TG---GIF--DGSGQYRVYKNLIK-------------SDFSTNQKPGADPRSHHLALA---THTT 114

  Fly   136 NGDFTFFDNLEMVVSRWRAPVSFAIHTPGYDLNTTLDAIRYVRNCLPESDSIKDWVSFHVY---- 196
            ..:   ..:||.::.||:.|:|.||...|.|:......|..:....|:..::   |.||:.    
Zfish   115 INN---LHHLESLLERWKNPISVAIFANGEDVKFATAIIYALSLFCPQVQAL---VDFHLVCHSG 173

  Fly   197 ----FPNQHMPEYVPYDEAEVLMYPHMCTLANGSLVSPLYTQIPTTDSYKSRA---NLTYPINVG 254
                ||:|....:|...|..       |......|.|       ..|.||:.|   |::||.|:.
Zfish   174 EMATFPDQDREHFVGLQEMG-------CPAVFAKLES-------HRDKYKNYAIGSNVSYPNNLL 224

  Fly   255 RNIARLATNTHFIFACDIELYPSVGFVDQFLDMVARNHSVLALDPRQRRRVYPLPVFEIETGAKV 319
            ||:||..|:..:|...||::.||.....||:.|:.:...  |.|     .|..||.|||....|:
Zfish   225 RNVARGGTDAAYILVIDIDMIPSANLHHQFVTMLMKREP--AAD-----EVLVLPAFEIRHIRKM 282

  Fly   320 PVDKDELLALYRKQQAQVFHLKLCPTCHTIPGQEEWLNRTSRADDHLHVFSKALRKWKFRAWEPF 384
            |..|.||:.||:..:.:.|:.:||..|........|:|..|::...|.| |..: .| ...||||
Zfish   283 PASKPELVQLYQVGEVRPFYDELCSRCQAPTNYSLWVNLASKSSGPLEV-SYTI-NW-VDPWEPF 344

  Fly   385 YVSDNTEPLFDERVTWEGQSNKRIQVSYYCSQVSVSQCNLLLQNYAMCLLDYEYHVLSPAFLVHS 449
            |:...:.||:||.....|.:    ::|..|.               :.:..|.:.|:|.|||:|.
Zfish   345 YIGARSVPLYDESFRQYGFN----RISQACE---------------LHIAGYRFSVVSNAFLLHK 390

  Fly   450 PGIK-----QSSKADSTRLQYAKEMTKFIKNKI 477
             |.|     .|.|.:..|           ||:|
Zfish   391 -GFKVQGEFHSRKDEENR-----------KNRI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11149NP_608952.2 Glyco_transf_49 130..485 CDD:290607 100/364 (27%)
b4gat1NP_001265757.1 Glyco_transf_49 109..424 CDD:290607 101/367 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579628
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49245
OrthoDB 1 1.010 - - D485184at33208
OrthoFinder 1 1.000 - - FOG0003642
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.