DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11149 and b4gat1

DIOPT Version :9

Sequence 1:NP_608952.2 Gene:CG11149 / 33800 FlyBaseID:FBgn0031732 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_002939368.2 Gene:b4gat1 / 100170600 XenbaseID:XB-GENE-1007367 Length:421 Species:Xenopus tropicalis


Alignment Length:489 Identity:108/489 - (22%)
Similarity:192/489 - (39%) Gaps:119/489 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VALLLVWRNLQQAQKLAASSNTGGQKSVGLLLSNESNPSRFSANFHLANDQHPKIIRREDSARTK 87
            :|||||  .|.|...|:..||..||:      ...:.|.....: |..:..|.::   ::..|..
 Frog    15 IALLLV--ALLQLLYLSLLSNLHGQQ------QRSAYPVPVGTS-HTGSQSHREL---KEHLRAA 67

  Fly    88 ELRSLLKCRDRSLRFERLQHGEFWLLQNLVMGRKSR----EVGCAESVTYTTNGDFTFFDNLEMV 148
            ::..:|   |.|        |::|:.::|:...|..    :|..|...:....|      :|:.:
 Frog    68 KVGGIL---DSS--------GQYWIYRHLLPHEKGNWKDLDVVLASHASVNNLG------HLQDL 115

  Fly   149 VSRWRAPVSFAIHTPGYDLNTTLDAIRYVRNCLPESDSIKDWVSFHVYFPNQHMPEYVPYDEAEV 213
            |..|...:|.|:.... .:...| |:.:|.........::..||||:...:           ::.
 Frog   116 VQHWDGRISLALFASN-AVQAKL-AVMFVYALSQLCPHVRQRVSFHLVCKS-----------SDR 167

  Fly   214 LMYPHMCTLANGSLVSPLYTQIPTTDSYKSRA------------NLTYPINVGRNIARLA-TNTH 265
            :.:|.:..|::       :..:|..::..|:|            |.:||.|:.||:||.. .:..
 Frog   168 VTFPELEDLSD-------FATLPNCEAVFSKAADMGIKVVNYAGNASYPNNLLRNVARAGIESAA 225

  Fly   266 FIFACDIELYPSVGFVDQFLDMVARNHSVLALDPRQRRRVYPLPVFEIETGAKVPVDKDELLALY 330
            ::...||::.||.|....|::        ||.....:..|:.:|.|||....::|..|:||:.||
 Frog   226 YVLVVDIDMVPSEGLRSGFVN--------LATGGVDQHLVFVVPAFEIRHTRRLPSTKEELMRLY 282

  Fly   331 RKQQAQVFHLKLCPTCHTIPGQEEWLNRTSRADDHLHVFSKALRK--------WKFRAWEPFYVS 387
            :..:.:.|:.:|||.|........|:|...:         |...|        || ..|||||:.
 Frog   283 QVGEVRAFYEELCPRCQAPTNYSLWINLPEK---------KPAAKLGVAYVVEWK-DPWEPFYIG 337

  Fly   388 DNTEPLFDERVTWEGQSNKRIQVSYYCSQVSVSQ-CNLLLQNYAMCLLDYEYHVLSPAFLVHS-- 449
            ....|.:|||....|.:.             :|| |.|.:..::..:||       .|||:|.  
 Frog   338 RADVPAYDERFKQYGFNR-------------ISQACELNMAGFSFAVLD-------SAFLLHKGH 382

  Fly   450 --PGIKQSSKADSTRLQYAKEMTKFIKNKIEPEY 481
              ||...|.|....|..  :::.:..|.::...|
 Frog   383 KLPGDFHSQKDAENRRN--RQLYRGFKEELRLRY 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11149NP_608952.2 Glyco_transf_49 130..485 CDD:290607 83/378 (22%)
b4gat1XP_002939368.2 Glyco_transf_49 97..414 CDD:404735 84/382 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49245
OrthoDB 1 1.010 - - D485184at33208
OrthoFinder 1 1.000 - - FOG0003642
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.