DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11149 and large2

DIOPT Version :9

Sequence 1:NP_608952.2 Gene:CG11149 / 33800 FlyBaseID:FBgn0031732 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001096468.1 Gene:large2 / 100125087 XenbaseID:XB-GENE-5871953 Length:723 Species:Xenopus tropicalis


Alignment Length:553 Identity:108/553 - (19%)
Similarity:175/553 - (31%) Gaps:174/553 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LWPVLILFNVALLL-------------VWRNLQQAQKLAASSNTGGQKSVGLLLSNESNPSRFSA 65
            ||.:...|....:|             :|:|.:....|....|||    |.|||.::.       
 Frog   223 LWAIFKKFTGEQVLGLVENQSDWYLGNLWKNHKPWPALGRGFNTG----VILLLLDKL------- 276

  Fly    66 NFHLANDQHPKIIRREDSARTKELRSLLKCRDRSLRFERLQHGEFWLLQNLVMGRKSREVGCAES 130
                      ::|..|:..|....|.|:.....||..:.:.:........||.     ::.|..:
 Frog   277 ----------RLIGWEEMWRLTAERELMNMLSTSLADQDIFNAVIKSSPTLVY-----QLPCYWN 326

  Fly   131 VTYT--TNGDFTFFDNLEMVVSRWRAPVSFAIHTPGYDLNTTLDAI----------RYVRNC--- 180
            |..:  |..:..:.:..::.|..|.:|....:.....:|..||...          |.:..|   
 Frog   327 VQLSDHTRSEQCYSELADLKVIHWNSPHKLRVKNKHVELFRTLYLTFLEYDGSLLRRELIGCPSE 391

  Fly   181 -------------LPESDSIKDW-------VSFHVYFPNQHMPEYVPYDEAEVL--------MYP 217
                         |.|.|...|:       ...|:.|.....|...|||...|.        |..
 Frog   392 GEQQGGSQAALSQLDEEDPCYDFRRESLASHRVHLSFLPHVTPPPDPYDVTLVAQLSMDRLQMLE 456

  Fly   218 HMCTLANGSLVSPLYTQ----------IPTTDSYKSRANLT----------YPINVGRNIARLAT 262
            .:|...:|.:...||..          ...::..:||.|:.          ||:|:.||:|...:
 Frog   457 LICRHWDGPMSLALYLSDAEAQQFLRYAQASEVLQSRTNVAYHVVYKEGQLYPVNLLRNVALKNS 521

  Fly   263 NTHFIFACDIELYPSVGFVDQFLDMVARNHSVLALDPRQRRRVYPLPVFE-IETGAKVPVDKDEL 326
            .|.::|..||:..|..|..:..      ..|:...|.....:...:|.|| :......|..|.||
 Frog   522 QTPYVFLSDIDFLPMYGLYEYL------RKSISQQDLTGPPKALIVPAFETLRYRLSFPKSKAEL 580

  Fly   327 LALYRKQQAQVFHLKL-----CPTCH------TIPGQEEWLNRTSRADDHLHVFSKALRKWKFRA 380
            |::........|...:     .||.:      |.|.:.||      |.|                
 Frog   581 LSMLDTGALYTFRYHVWEKGHAPTDYAKWRTATTPYRVEW------APD---------------- 623

  Fly   381 WEPFYVSDNTEPLFDERVTWEGQSNKRIQVSYYCSQVSVSQCNLLLQNYAMCLLDYEYH---VLS 442
            :||:.|.....|.:|:|....|.:    :||:...                  ||.:.|   ||.
 Frog   624 FEPYVVVRRDCPEYDQRFLGFGWN----KVSHIME------------------LDAQEHELLVLP 666

  Fly   443 PAFLVHSP-----GIKQSSKADSTRL--QYAKE 468
            .||::|.|     .|.:...:::.||  |..||
 Frog   667 NAFIIHMPHAPSFDISKFRSSENYRLCVQALKE 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11149NP_608952.2 Glyco_transf_49 130..485 CDD:290607 84/424 (20%)
large2NP_001096468.1 GT8_LARGE_C 107..386 CDD:133053 33/188 (18%)
Glyco_transf_49 440..709 CDD:290607 65/310 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D729091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.