DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14007 and CG34011

DIOPT Version :9

Sequence 1:NP_001097090.2 Gene:CG14007 / 33799 FlyBaseID:FBgn0031731 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001033878.3 Gene:CG34011 / 3885619 FlyBaseID:FBgn0054011 Length:276 Species:Drosophila melanogaster


Alignment Length:315 Identity:94/315 - (29%)
Similarity:153/315 - (48%) Gaps:56/315 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLMESYMCYCSVRLGVIIVSVLAIIREFAHSITLFALGVKVFEPLIDLFEHDAEYKDRKWVRKS 65
            |:|||||....||||||::..:.|||:.......:||.|.......|::.|  ..||..:.|::|
  Fly     1 MVLMESYFFCASVRLGVLVTCIAAIIKNTIFMWLIFANGTTFLYFFINILE--TYYKTSRIVKES 63

  Fly    66 ISWSQNDPEILCAFVHVISFMHSAAAFLSIYGAIKLRKWFLLPLAFCEFVYFIHITFLHIVLMIM 130
            ::|:::..:.|..|:.:.||.:.|...|:.|||.||:|:.::|||..||:|.:.:..|.|:.:.:
  Fly    64 VTWAEHYSKELMVFMQLYSFCYIATCVLAAYGAYKLKKYHVVPLAIFEFIYTVQVVVLVIITLRI 128

  Fly   131 LKKQINLGLLIILTLLGCFYILFVGYNACTCVAMFQIIGLVKSARYCELYGDDPFHPLAMRSNRS 195
            .:..:.|..||::||...||.:.|.|:....:|..||:.||:|.||..|||.||.:|:       
  Fly   129 ARHIVPLATLILMTLALSFYAMLVAYDTLALIAFVQIMFLVRSQRYIRLYGPDPLNPV------- 186

  Fly   196 KDSEKPLHVLRMHDMHDTNIDEEKRLSKLGLWP-RRQPPVVSVLPV--QAAYPQPPLKWWQLQAL 257
                             ||..:.|:::.:.  | .:||.::.|:|.  |..:..|..||||    
  Fly   187 -----------------TNGVQSKQMASIN--PISQQPIIIYVMPKAGQKLWDLPQSKWWQ---- 228

  Fly   258 STGDDHQPDPSVYRN---------WHTNELLNGVGGDVQRKSELNRRYAENQLHR 303
                |.:.|.:|.:|         :...|||:        |..|.....|:.||:
  Fly   229 ----DEKTDDNVPQNINYEESSEFFQRQELLS--------KVLLRNAIKEDYLHK 271



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460595
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019720
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.