DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and PRPF4B

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_003904.3 Gene:PRPF4B / 8899 HGNCID:17346 Length:1007 Species:Homo sapiens


Alignment Length:342 Identity:96/342 - (28%)
Similarity:156/342 - (45%) Gaps:50/342 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YRPQGSSKMD-RYEKLSRLGEGSYGVVYKCRDR-ETGALVAVKRFVESEDDPAIRKIALREIRLL 101
            ||......:| ||......|:|.:..|.:.||. .....||||....:|   .::|..|:|:..|
Human   675 YRVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNE---LMQKTGLKELEFL 736

  Fly   102 KNLKHP------NLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHL--TKQICYQTLL 158
            |.|...      :.:.|...|..|:.|.||||...:.:...|:::.:....|:  .:....|..|
Human   737 KKLNDADPDDKFHCLRLFRHFYHKQHLCLVFEPLSMNLREVLKKYGKDVGLHIKAVRSYSQQLFL 801

  Fly   159 GVAYCHKQGCLHRDIKPENILLTAQGQV-KLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDT 222
            .:....:...||.||||:|||:.....: ||||||.|..::..: .|.|:.:|:|||||:::|.:
Human   802 ALKLLKRCNILHADIKPDNILVNESKTILKLCDFGSASHVADND-ITPYLVSRFYRAPEIIIGKS 865

  Fly   223 -QYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHI-------QIFGQNEY 279
             .||  :|:|::||...||..|:.|:||:::...|.|.....|.:..:.|       |.|.||..
Human   866 YDYG--IDMWSVGCTLYELYTGKILFPGKTNNHMLKLAMDLKGKMPNKMIRKGVFKDQHFDQNLN 928

  Fly   280 FKGI---------TLPVPPTLEPLED---------KMPAKSQQNPLTIDFLKKCLDK----DPTK 322
            |..|         .:.|..|:.|.:|         ::|...::.   :..||..||:    ||.|
Human   929 FMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKK---VHQLKDLLDQILMLDPAK 990

  Fly   323 RWSCEKLTKHSYFDDYI 339
            |.|..:..:|::..:.|
Human   991 RISINQALQHAFIQEKI 1007

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 93/327 (28%)
Pkinase 50..335 CDD:278497 91/324 (28%)
PRPF4BNP_003904.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..99
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..533
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 559..583
STKc_PRP4 686..1003 CDD:271037 92/325 (28%)
S_TKc 694..1003 CDD:214567 90/317 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.