DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and CDK10

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_011521707.1 Gene:CDK10 / 8558 HGNCID:1770 Length:392 Species:Homo sapiens


Alignment Length:368 Identity:118/368 - (32%)
Similarity:169/368 - (45%) Gaps:73/368 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EPDL----VETRQYRPQG------------SSKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAV 78
            ||||    :..:..|.:|            ...:..:|||:|:|||:||:||:.||.:|..:||:
Human     3 EPDLECEQIRLKCIRKEGFFTVPPEHRLGRCRSVKEFEKLNRIGEGTYGIVYRARDTQTDEIVAL 67

  Fly    79 KRFVESEDDPAIRKIALREIRLLKNLKHPNLVSLLEVF--RRKRRLHLVFEFCELTVLHELERHP 141
            |:....::...|...:||||.||..|:|||:|.|.||.  .....:.||..:||..:...||..|
Human    68 KKVRMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMP 132

  Fly   142 QGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARMLS-PGENYTD 205
            ....|...|.|..|.|.|:.|.|:...:|||:|..|:|:|.:|.||..|||.||... |.:..|.
Human   133 TPFSEAQVKCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVKPMTP 197

  Fly   206 YVATRWYRAPELLVGDTQYGTPVDVW--------------------------------AIGCLFA 238
            .|.|.||||||||:|.|...|.:|:|                                |:||:.|
Human   198 KVVTLWYRAPELLLGTTTQTTSIDMWVSKGLAAVRSSVPRAGGVSRRLAAVRSTVLCRAVGCILA 262

  Fly   239 ELVRGEALWPGRSDVDQLYLIRKTLG----DLLP--RHIQIFGQNEYFKGITLPVPPTLEP---L 294
            ||:....|.||.|::.|:.||.:.||    ::.|  ..:.:.||....|          :|   |
Human   263 ELLAHRPLLPGTSEIHQIDLIVQLLGTPSENIWPGFSKLPLVGQYSLRK----------QPYNNL 317

  Fly   295 EDKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDD 337
            :.|.|..|:.....:.||   ...||.||.:.....:.|||.:
Human   318 KHKFPWLSEAGLRLLHFL---FMYDPKKRATAGDCLESSYFKE 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 110/330 (33%)
Pkinase 50..335 CDD:278497 110/328 (34%)
CDK10XP_011521707.1 STKc_CDK10 31..371 CDD:173742 112/340 (33%)
PTZ00024 43..368 CDD:240233 109/328 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.