DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and KIN28

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_010175.1 Gene:KIN28 / 851450 SGDID:S000002266 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:291 Identity:101/291 - (34%)
Similarity:160/291 - (54%) Gaps:8/291 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVSLLE 114
            |.|..::|||:|.|||......||..:|:|....||....:...|:||::.|:.::|||::.|::
Yeast     7 YTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELID 71

  Fly   115 VFRRKRRLHLVFEF--CELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPEN 177
            :|.....|:||.||  .:|.|:.: ::.....|..: |.....||.||.:||:...||||:||.|
Yeast    72 IFMAYDNLNLVLEFLPTDLEVVIK-DKSILFTPADI-KAWMLMTLRGVYHCHRNFILHRDLKPNN 134

  Fly   178 ILLTAQGQVKLCDFGFARML-SPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELV 241
            :|.:..||:|:.|||.||.: :|.|..|..|.||||||||||.|...|.:.:|:|::|.:||||:
Yeast   135 LLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELM 199

  Fly   242 RGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPLEDKMPAKSQQNP 306
            ......||::||||:.:..:.||....|..........:..:.:..||:.:.|..:..|.|:   
Yeast   200 LRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPPPSRDELRKRFIAASE--- 261

  Fly   307 LTIDFLKKCLDKDPTKRWSCEKLTKHSYFDD 337
            ..:||:...|..:|.|||:..:..:..||.:
Yeast   262 YALDFMCGMLTMNPQKRWTAVQCLESDYFKE 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 99/287 (34%)
Pkinase 50..335 CDD:278497 99/287 (34%)
KIN28NP_010175.1 STKc_CDK7 7..302 CDD:270833 101/291 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.