DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and Cilk1

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_620241.1 Gene:Cilk1 / 84411 RGDID:71050 Length:629 Species:Rattus norvegicus


Alignment Length:404 Identity:130/404 - (32%)
Similarity:199/404 - (49%) Gaps:61/404 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVK----RFVESEDDPAIRKIALREIRLLKNLKHP 107
            |:||..:.:||:|:||.|...|..|:|.|:|:|    :|...|:     .:.|||::.||.|.|.
  Rat     1 MNRYTTIKQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEE-----CMNLREVKSLKKLNHA 60

  Fly   108 NLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRD 172
            |:|.|.||.|....|:.:||:.:..:...::...:..||...:.|.||.|.|:|:.||.|..|||
  Rat    61 NIVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRD 125

  Fly   173 IKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLF 237
            :||||:|......||:.|||.||.:.....|||||:||||||||:|:..|.|.:|:||||:||:.
  Rat   126 LKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIM 190

  Fly   238 AELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLP----------VPPTLE 292
            ||:.....|:||.|::|.::.|.:.||  .|:      :.::.:|..|.          :|..|:
  Rat   191 AEVYTLRPLFPGASEIDTIFKICQVLG--TPK------KTDWPEGYQLSSAMNFIWPQCIPNNLK 247

  Fly   293 PLEDKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDDYIAKQRELEHVNSLEAANLR 357
            .|   :|..|.:   .|..|:..|..||.||.:..:..::.||        ::.|...:...:..
  Rat   248 TL---IPNASSE---AIQLLRDLLQWDPKKRPTASQALRYPYF--------QIGHPLGISTQDSG 298

  Fly   358 QQQLASQQFMLATAAQQLQTGP---AQAAAIAAARDKSKTSNTSLPLLPSTQHHHHPHQDYVKLQ 419
            :.|...|.          :|||   .:.|..|.|..|:.|..:|.|...|     .|||.:|  .
  Rat   299 KPQKDVQD----------KTGPPPYVKPAPPAQAPTKAHTLISSRPNQAS-----QPHQHFV--Y 346

  Fly   420 PLNKNANLLHRTEH 433
            |....|:...:..|
  Rat   347 PYKGEASRTEQLSH 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 106/300 (35%)
Pkinase 50..335 CDD:278497 105/298 (35%)
Cilk1NP_620241.1 STKc_MAK_like 4..284 CDD:270824 105/298 (35%)
S_TKc 4..284 CDD:214567 105/298 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..322 7/39 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 454..482
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 579..629
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.