DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and CAK4

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_176847.1 Gene:CAK4 / 842993 AraportID:AT1G66750 Length:348 Species:Arabidopsis thaliana


Alignment Length:293 Identity:120/293 - (40%)
Similarity:161/293 - (54%) Gaps:13/293 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVS 111
            :|||.:...||||:||||||..|.:||..||||:.........:...|||||:|||.|.||::|.
plant    10 VDRYLRRQILGEGTYGVVYKATDTKTGKTVAVKKIRLGNQKEGVNFTALREIKLLKELNHPHIVE 74

  Fly   112 LLEVFRRKRRLHLVFEFCELTVLHEL--ERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIK 174
            |::.|.....||||||:.: |.|..:  :|:....|..: |.....||.|:|||||:..||||:|
plant    75 LIDAFPHDGSLHLVFEYMQ-TDLEAVIRDRNIFLSPGDI-KSYMLMTLKGLAYCHKKWVLHRDMK 137

  Fly   175 PENILLTAQGQVKLCDFGFARML-SPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFA 238
            |.|:|:...|.:||.|||.||:. ||...:|..|...||||||||.|..|||..|||||.||:||
plant   138 PNNLLIGENGLLKLADFGLARLFGSPNRRFTHQVFATWYRAPELLFGSRQYGAGVDVWAAGCIFA 202

  Fly   239 ELVRGEALWPGRSDVDQLYLIRKTLGDLLP-RHIQIFGQNEYFKGITLPVPPTLEPLEDKMPAKS 302
            ||:......||.:::|||..|.:..|..:| :...:....:|.:....|.|    ||....|..|
plant   203 ELLLRRPFLPGSTEIDQLGKIFQAFGTPVPSQWSDMIYLPDYMEFSYTPAP----PLRTIFPMAS 263

  Fly   303 QQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYF 335
            ..   .:|.|.|....||.:|.:.::...|.||
plant   264 DD---ALDLLAKMFIYDPRQRITIQQALDHRYF 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 118/290 (41%)
Pkinase 50..335 CDD:278497 116/288 (40%)
CAK4NP_176847.1 STKc_CDK7 12..305 CDD:270833 119/291 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.