DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and AT1G57700

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_176083.2 Gene:AT1G57700 / 842146 AraportID:AT1G57700 Length:692 Species:Arabidopsis thaliana


Alignment Length:414 Identity:127/414 - (30%)
Similarity:199/414 - (48%) Gaps:64/414 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVSL 112
            |.:|||..:|:|:|..||:.||.||..:||:|:...:..||...:...|||.:|:.|.|||::.|
plant   144 DSFEKLEMIGQGTYSSVYRARDLETNQIVALKKVRFANMDPESVRFMAREIIILRRLNHPNVMKL 208

  Fly   113 --LEVFRRKRRLHLVFEFCELTVLHELE--RHPQGCPEHLTKQICY--QTLLGVAYCHKQGCLHR 171
              |.:.:....::|:||:.:    |:|.  ....|......:..||  |.|||:.:||..|.|||
plant   209 EGLIISKASGSMYLIFEYMD----HDLAGLASTPGIKFSQAQIKCYMKQLLLGLEHCHSCGVLHR 269

  Fly   172 DIKPENILLTAQGQVKLCDFGFARMLSPGEN---YTDYVATRWYRAPELLVGDTQYGTPVDVWAI 233
            |||..|:||.....:|:.|||.:.... |:.   .|..|.|.|||.||||:|.|.||..||:|:.
plant   270 DIKCSNLLLDRNNNLKIGDFGLSNFYR-GQRKQPLTSRVVTLWYRPPELLLGSTDYGVTVDLWST 333

  Fly   234 GCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLP----------RHIQIF-GQNEY-------F 280
            ||:.|||..|:.|.|||::|:|::.|.|..|.  |          ||..|| .|:.|       |
plant   334 GCILAELFTGKPLLPGRTEVEQMHKIFKLCGS--PSEEYWRRSRLRHATIFKPQHPYKRCVADTF 396

  Fly   281 KGI------TLPVPPTLEPLEDKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDDYI 339
            |.:      .|.|...:||......:.:.|:..   |..|....:|:      .|.::....::.
plant   397 KDLPSSALALLEVLLAVEPDARGTASSALQSEF---FTTKPFPSEPS------SLPRYQPRKEFD 452

  Fly   340 AKQRELEHVNSLEAANLRQQQLASQQFMLATAAQQLQTGPAQAAAIAAARDK-SKTSNTSLPLLP 403
            ||.|| |.....:.::.:|    ::|..||..::.:....|.|..:|:.:.: .:|:.||:    
plant   453 AKLRE-EEARRRKGSSSKQ----NEQKRLARESKAVPAPSANAELLASIQKRLGETNRTSI---- 508

  Fly   404 STQHHHHPHQDY---VKLQPLNKN 424
              ....:|..|.   .:::||..|
plant   509 --SEKFNPEGDSGNGFRIEPLKGN 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 107/319 (34%)
Pkinase 50..335 CDD:278497 106/317 (33%)
AT1G57700NP_176083.2 PKc_like 146..430 CDD:304357 102/293 (35%)
PTZ00024 152..443 CDD:240233 102/306 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.