DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and MAP3KA

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_564635.1 Gene:MAP3KA / 841792 AraportID:AT1G53570 Length:609 Species:Arabidopsis thaliana


Alignment Length:402 Identity:89/402 - (22%)
Similarity:153/402 - (38%) Gaps:109/402 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PQGSSKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIR---KIALREIRLLK 102
            |.|.|   .::|...||.|::|.||...:.|.|.:.|:|......||...:   |...:||.||.
plant   208 PSGFS---TWKKGKFLGSGTFGQVYLGFNSEKGKMCAIKEVKVISDDQTSKECLKQLNQEINLLN 269

  Fly   103 NLKHPNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQG 167
            .|.|||:|........:..|.:..|:.....:|:|.:......|.:.:....|.|.|:||.|.:.
plant   270 QLCHPNIVQYYGSELSEETLSVYLEYVSGGSIHKLLKDYGSFTEPVIQNYTRQILAGLAYLHGRN 334

  Fly   168 CLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWA 232
            .:|||||..|||:...|::||.|||.|:.::.......:..:.::.|||:::....|...||:|:
plant   335 TVHRDIKGANILVDPNGEIKLADFGMAKHVTAFSTMLSFKGSPYWMAPEVVMSQNGYTHAVDIWS 399

  Fly   233 IGCLFAELVRGEALWPGRSDVDQLYLIRKTLG-DLLPRHIQIFGQNEYFKGITLPVPPTLEPLED 296
            :||...|:...:..|.....|..::.|..:.. ..:|.|:....:|                   
plant   400 LGCTILEMATSKPPWSQFEGVAAIFKIGNSKDTPEIPDHLSNDAKN------------------- 445

  Fly   297 KMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDDYIAKQRELEHVNSLEAANLRQQQL 361
                          |::.||.::||.|.:..:|.:|.:.                          
plant   446 --------------FIRLCLQRNPTVRPTASQLLEHPFL-------------------------- 470

  Fly   362 ASQQFMLATAAQQLQTGPAQAAAIAAARDKSKTSNTSLP-------------LLPSTQHH--HHP 411
                                       |:.::.::||||             |.|:.:.:  ...
plant   471 ---------------------------RNTTRVASTSLPKDFPPRSYDGNFSLQPTREPYPGRLS 508

  Fly   412 HQDYVKLQPLNK 423
            |.:|.| |||::
plant   509 HDNYAK-QPLSR 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 73/290 (25%)
Pkinase 50..335 CDD:278497 73/288 (25%)
MAP3KANP_564635.1 STKc_MEKK1_plant 213..470 CDD:270802 73/289 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.