DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and ATMAP4K ALPHA1

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001185209.1 Gene:ATMAP4K ALPHA1 / 841750 AraportID:AT1G53165 Length:688 Species:Arabidopsis thaliana


Alignment Length:361 Identity:91/361 - (25%)
Similarity:151/361 - (41%) Gaps:59/361 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RYEKLSRLGEGSYGVVYKCRDRETGALVAVK--RFVESEDDPAIRKIALREIRLLKNLKHPNLVS 111
            |:.:...:|.||:|.|||..|.|....||:|  ...||||:  |..|. :||.:|...:.|.:..
plant    14 RFSQFELIGRGSFGDVYKAFDTELNKDVAIKVIDLEESEDE--IEDIQ-KEISVLSQCRCPYITE 75

  Fly   112 LLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPE 176
            ....:..:.:|.::.|:.....:.:|.:......|.....|....|..|.|.|.:|.:|||||..
plant    76 YYGSYLHQTKLWIIMEYMAGGSVADLLQPGNPLDEISIACITRDLLHAVEYLHAEGKIHRDIKAA 140

  Fly   177 NILLTAQGQVKLCDFGFARMLSPG-ENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAEL 240
            ||||:..|.||:.|||.:..|:.. .....:|.|.::.|||::.....|....|:|::|....|:
plant   141 NILLSENGDVKVADFGVSAQLTRTISRRKTFVGTPFWMAPEVIQNSEGYNEKADIWSLGITMIEM 205

  Fly   241 VRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPLEDKMPAKSQQN 305
            .:||                ..|.||.|..:...        |....||.|:        :....
plant   206 AKGE----------------PPLADLHPMRVLFI--------IPRESPPQLD--------EHFSR 238

  Fly   306 PLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDDYIAKQRELEHVNSLEAANLRQQQLASQQFMLAT 370
            ||. :|:..||.|.|.:|.:.::|.||.:..:.....:.||.:.......:::.           
plant   239 PLK-EFVSFCLKKAPAERPNAKELLKHRFIKNARKSPKLLERIRERPKYQVKED----------- 291

  Fly   371 AAQQLQT----GPAQAA-AIAAARDK--SKTSNTSL 399
              :::.|    .||::: .:..|:|:  ..||.|.|
plant   292 --EEIPTNGPKAPAESSGTVRVAKDERGQGTSGTRL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 80/288 (28%)
Pkinase 50..335 CDD:278497 79/287 (28%)
ATMAP4K ALPHA1NP_001185209.1 STKc_MST3_like 14..287 CDD:270786 82/308 (27%)
S_TKc 19..267 CDD:214567 79/283 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.