DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and AT1G33770

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_174637.1 Gene:AT1G33770 / 840268 AraportID:AT1G33770 Length:614 Species:Arabidopsis thaliana


Alignment Length:311 Identity:107/311 - (34%)
Similarity:159/311 - (51%) Gaps:43/311 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLV 110
            :.|.:|||.::|:|:|.:|||.||.|||.:||:|:...:..||...:...|||.:|:.|.|||::
plant   137 RADSFEKLDKIGQGTYSIVYKARDLETGKIVAMKKVRFANMDPESVRFMAREINILRKLDHPNVM 201

  Fly   111 SL--LEVFRRKRRLHLVFEFCELTVLHELE----------RHPQGCPEHLTKQICYQTLLGVAYC 163
            .|  |...:....||||||:.|    |:|.          ..||      .|....|.|.|:.:|
plant   202 KLQCLVTSKLSGSLHLVFEYME----HDLSGLALRPGVKFTEPQ------IKCFMKQLLCGLEHC 256

  Fly   164 HKQGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGEN--YTDYVATRWYRAPELLVGDTQYGT 226
            |.:|.||||||..|:|:...|.:|:.|||.|....|.::  .|..|.|.||||||||:|.|:||.
plant   257 HSRGILHRDIKGSNLLVNNDGVLKIGDFGLASFYKPDQDQPLTSRVVTLWYRAPELLLGSTEYGP 321

  Fly   227 PVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTL 291
            .:|:|::||:.|||...:.:.|||::|:|::.|.|..|.         ...|::.....|...:.
plant   322 AIDLWSVGCILAELFVCKPIMPGRTEVEQMHKIFKLCGS---------PSEEFWNTTKFPQATSY 377

  Fly   292 EPLEDKMPAK-------SQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYF 335
            :|   :.|.|       ...:..::|.|.|.|..:|.||.|........:|
plant   378 KP---QHPYKRVLLETFKNLSSSSLDLLDKLLSVEPEKRCSASSTLLSEFF 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 106/307 (35%)
Pkinase 50..335 CDD:278497 105/305 (34%)
AT1G33770NP_174637.1 STKc_CDK9_like 141..425 CDD:270832 105/305 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.