DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and MPK11

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001117210.1 Gene:MPK11 / 839523 AraportID:AT1G01560 Length:369 Species:Arabidopsis thaliana


Alignment Length:299 Identity:99/299 - (33%)
Similarity:157/299 - (52%) Gaps:33/299 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVSLLEVFR 117
            |..:|.|:.|:|....:.|||..||:|:...:..:....|..||||:|||::.|.|:::::::.|
plant    43 LRPIGRGASGIVCAAWNSETGEEVAIKKIGNAFGNIIDAKRTLREIKLLKHMDHDNVIAIIDIIR 107

  Fly   118 RKR-----RLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPEN 177
            ..:     .:|:|:|..: |.||.:.|..|...:..::...||.|.|:.|.|....||||:||.|
plant   108 PPQPDNFNDVHIVYELMD-TDLHHIIRSNQPLTDDHSRFFLYQLLRGLKYVHSANVLHRDLKPSN 171

  Fly   178 ILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELVR 242
            :||.|...:|:.|||.||..|..:..|:||.||||||||||:..::|...:|:|::||:..|::.
plant   172 LLLNANCDLKIGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMT 236

  Fly   243 GEALWPGRSDVDQLYLIRKTLG------------DLLPRHIQIFGQNEYFKGITLPVPPTLEPLE 295
            .|.|:|||..|.||.||.:.:|            |...|:::           .||..|. :...
plant   237 REPLFPGRDYVQQLRLITELIGSPDDSSLGFLRSDNARRYVR-----------QLPQYPR-QNFA 289

  Fly   296 DKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSY 334
            .:.|..|..   .:|.|:|.|..||.:|.:.::...|.|
plant   290 ARFPNMSVN---AVDLLQKMLVFDPNRRITVDEALCHPY 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 99/299 (33%)
Pkinase 50..335 CDD:278497 99/299 (33%)
MPK11NP_001117210.1 STKc_TEY_MAPK 33..369 CDD:143363 99/299 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.