DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and NP1

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_563832.2 Gene:NP1 / 837421 AraportID:AT1G09000 Length:666 Species:Arabidopsis thaliana


Alignment Length:368 Identity:106/368 - (28%)
Similarity:157/368 - (42%) Gaps:67/368 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFHSSSFYLPQSLQNSFLYRLIQKIQVC------------NEPDLVETRQYRPQGSSKMDRYEKL 53
            :|..||....|..|..|...|..||..|            :.|....|....|..|     :.|.
plant    13 VFRPSSDDDNQENQPPFPGVLADKITSCIRKSKIFIKPSFSPPPPANTVDMAPPIS-----WRKG 72

  Fly    54 SRLGEGSYGVVYKCRDRETGALVAVKR------FVESEDDPAIRKIALREIRLLKNLKHPNLVSL 112
            ..:|.|::|.||...:.::|.|:|||:      |...|...|..:....|::|||||.|||:|..
plant    73 QLIGRGAFGTVYMGMNLDSGELLAVKQVLIAANFASKEKTQAHIQELEEEVKLLKNLSHPNIVRY 137

  Fly   113 LEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPEN 177
            |...|....|:::.||.....:..|.......||.:.:....|.|||:.|.|....:|||||..|
plant   138 LGTVREDDTLNILLEFVPGGSISSLLEKFGPFPESVVRTYTRQLLLGLEYLHNHAIMHRDIKGAN 202

  Fly   178 ILLTAQGQVKLCDFGFARMLSPGENYT---DYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAE 239
            ||:..:|.:||.|||.::.::.....|   ....|.::.|||::: .|.:....|:|::||...|
plant   203 ILVDNKGCIKLADFGASKQVAELATMTGAKSMKGTPYWMAPEVIL-QTGHSFSADIWSVGCTVIE 266

  Fly   240 LVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITL---PVPPTLEPLEDKMPAK 301
            :|.|:|.|      .|.|   |.:..:            :|.|.|.   |:|.||     ...||
plant   267 MVTGKAPW------SQQY---KEVAAI------------FFIGTTKSHPPIPDTL-----SSDAK 305

  Fly   302 SQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDDYIAKQRE 344
                    |||.|||.:.|..|.:..:|.||.:   .:.|.:|
plant   306 --------DFLLKCLQEVPNLRPTASELLKHPF---VMGKHKE 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 90/298 (30%)
Pkinase 50..335 CDD:278497 90/296 (30%)
NP1NP_563832.2 STKc_MAPKKK 68..331 CDD:270783 91/305 (30%)
S_TKc 69..331 CDD:214567 90/299 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.