DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and MKK3

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001318713.1 Gene:MKK3 / 834042 AraportID:AT5G40440 Length:520 Species:Arabidopsis thaliana


Alignment Length:351 Identity:84/351 - (23%)
Similarity:142/351 - (40%) Gaps:78/351 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SSKMDRYEKLSRLGEGSYGVVYKCRDRE--------TGALVAVKRFVESEDDPAIRKIALREIRL 100
            ||.:|..|        |....|:|...|        :||...|:|.:..   |..|.:||::|.:
plant    63 SSHVDESE--------SSETTYQCASHEMRVFGAIGSGASSVVQRAIHI---PNHRILALKKINI 116

  Fly   101 LKNLK----------------HPNLVSLLEVFRR--KRRLHLVFEFCELTVLHELERHPQGCPEH 147
            .:..|                |..||.....|..  ..::.:..|:.....|.::.:..:..||.
plant   117 FEREKRQQLLTEIRTLCEAPCHEGLVDFHGAFYSPDSGQISIALEYMNGGSLADILKVTKKIPEP 181

  Fly   148 LTKQICYQTLLGVAYCH-KQGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGEN----YTDYV 207
            :...:.::.|.|::|.| .:..:||||||.|:|:..:|:.|:.|||.:..|   ||    ...:|
plant   182 VLSSLFHKLLQGLSYLHGVRHLVHRDIKPANLLINLKGEPKITDFGISAGL---ENSMAMCATFV 243

  Fly   208 ATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQ 272
            .|..|.:||.:..|: |..|.|:|::|....|...||  :|..::...:.|:.:.|.|       
plant   244 GTVTYMSPERIRNDS-YSYPADIWSLGLALFECGTGE--FPYIANEGPVNLMLQILDD------- 298

  Fly   273 IFGQNEYFKGITLPVPPTLEPLEDKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDD 337
                       ..|.||           |.:.:|....|:..||.|||..|.:.::|..|.:...
plant   299 -----------PSPTPP-----------KQEFSPEFCSFIDACLQKDPDARPTADQLLSHPFITK 341

  Fly   338 YIAKQREL-EHVNSLEAANLRQQQLA 362
            :..::.:| ..|.|:.....|.:.||
plant   342 HEKERVDLATFVQSIFDPTQRLKDLA 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 76/317 (24%)
Pkinase 50..335 CDD:278497 75/315 (24%)
MKK3NP_001318713.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.