DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and MAPKKK9

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_192588.1 Gene:MAPKKK9 / 826407 AraportID:AT4G08480 Length:773 Species:Arabidopsis thaliana


Alignment Length:299 Identity:86/299 - (28%)
Similarity:132/299 - (44%) Gaps:45/299 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GSSKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRF----VESEDDPAIRKIALREIRLLKN 103
            |.|....::|...|.:||:|.||:... |.|...|||..    ..|:....|:::. .||.||..
plant   494 GGSINTSWQKGQLLRQGSFGSVYEAIS-EDGDFFAVKEVSLLDQGSQAQECIQQLE-GEIALLSQ 556

  Fly   104 LKHPNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGC 168
            |:|.|::......:....|::..|......|.||.|..| ..:.|......|.|.|:.|.|.:|.
plant   557 LEHQNILRYRGTDKDGSNLYIFLELVTQGSLLELYRRYQ-IRDSLISLYTKQILDGLKYLHHKGF 620

  Fly   169 LHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELL--VGDTQYGTPVDVW 231
            :|||||...||:.|.|.|||.|||.|: :|...:......|.::.|||::  ..:..|.:|.|:|
plant   621 IHRDIKCATILVDANGTVKLADFGLAK-VSKLNDIKSRKETLFWMAPEVINRKDNDGYRSPADIW 684

  Fly   232 AIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLP-VPPTLEPLE 295
            ::||...|:..|:..:.....|:.|:.||:.                     ||| ||.||    
plant   685 SLGCTVLEMCTGQIPYSDLEPVEALFRIRRG---------------------TLPEVPDTL---- 724

  Fly   296 DKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSY 334
             .:.|:        .|:.|||..:|.:|.:..:|..|.:
plant   725 -SLDAR--------HFILKCLKLNPEERPTATELLNHPF 754

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 84/294 (29%)
Pkinase 50..335 CDD:278497 84/292 (29%)
MAPKKK9NP_192588.1 PKc_like 500..755 CDD:304357 84/293 (29%)
S_TKc 501..755 CDD:214567 84/292 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.