DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and NEK6

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001327688.1 Gene:NEK6 / 823542 AraportID:AT3G44200 Length:956 Species:Arabidopsis thaliana


Alignment Length:344 Identity:96/344 - (27%)
Similarity:155/344 - (45%) Gaps:63/344 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SKMDRYEKLSRLGEGSYG---VVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKH 106
            |:||:||.:.::|.|::|   :|:...:|:...|..::...::|   ..|:.|.:|:.|:..::|
plant     3 SRMDQYELMEQIGRGAFGAAILVHHKAERKKYVLKKIRLARQTE---RCRRSAHQEMSLIARVQH 64

  Fly   107 PNLVSLLEVFRRKR-RLHLVFEFCELTVLHELERHPQGC--PEHLTKQIC---YQTLLGVAYCHK 165
            |.:|...|.:..|. .:.:|..:||...:.||.:...|.  ||   :::|   .|.||.|.|.|.
plant    65 PYIVEFKEAWVEKGCYVCIVTGYCEGGDMAELMKKSNGVYFPE---EKLCKWFTQLLLAVEYLHS 126

  Fly   166 QGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDV 230
            ...||||:|..||.||....|:|.|||.|:.|...:..:..|.|..|..|||| .|..||...|:
plant   127 NYVLHRDLKCSNIFLTKDQDVRLGDFGLAKTLKADDLTSSVVGTPNYMCPELL-ADIPYGFKSDI 190

  Fly   231 WAIGCLFAELVRGEALWPGRSDVDQLYLI----RKTLGDLLPRHIQIFGQNEYFKGITLPVPPTL 291
            |::||...|:.   |..|.....|...||    |.::|                     |:||..
plant   191 WSLGCCIYEMA---AYRPAFKAFDMAGLISKVNRSSIG---------------------PLPPCY 231

  Fly   292 EPLEDKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDDYIAKQRELEHVNSLEAANL 356
            .|   .:.|          .:|..|.|:|..|.:..::.||.|...|:.:.|.     :|.||::
plant   232 SP---SLKA----------LIKGMLRKNPEYRPNASEILKHPYLQPYVEQYRP-----TLSAASI 278

  Fly   357 R-QQQLASQQFMLATAAQQ 374
            . ::.|.|::...:.|..|
plant   279 TPEKPLNSREGRRSMAESQ 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 84/299 (28%)
Pkinase 50..335 CDD:278497 83/297 (28%)
NEK6NP_001327688.1 STKc_Nek 7..262 CDD:270855 83/298 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.