DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and CDKL5

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001032420.1 Gene:CDKL5 / 6792 HGNCID:11411 Length:1030 Species:Homo sapiens


Alignment Length:412 Identity:154/412 - (37%)
Similarity:224/412 - (54%) Gaps:56/412 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PQGSSKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLK 105
            |...:.|:::|.|..:|||:||||.|||.:||..:||:|:|.:||::..:::..|||:::|:.||
Human     4 PNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKETTLRELKMLRTLK 68

  Fly   106 HPNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLH 170
            ..|:|.|.|.|||:.:|:||||:.|..:|..||..|.|.|....|...||.:..:.:|||...:|
Human    69 QENIVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKVKSYIYQLIKAIHWCHKNDIVH 133

  Fly   171 RDIKPENILLTAQGQVKLCDFGFARMLSPGE--NYTDYVATRWYRAPELLVGDTQYGTPVDVWAI 233
            |||||||:|::....:|||||||||.||.|.  |||:||||||||:||||:| ..||..||:|::
Human   134 RDIKPENLLISHNDVLKLCDFGFARNLSEGNNANYTEYVATRWYRSPELLLG-APYGKSVDMWSV 197

  Fly   234 GCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPLEDKM 298
            ||:..||..|:.|:||.|::|||:.|:|.||.|....:::|..|..|.|:..|.....:.||.:.
Human   198 GCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPSEQMKLFYSNPRFHGLRFPAVNHPQSLERRY 262

  Fly   299 PAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDDYIAKQRELE------------HVNSL 351
              ....|.:.:|.:|..|..||..|:..|:...|..|.    .||.|:            ||.|.
Human   263 --LGILNSVLLDLMKNLLKLDPADRYLTEQCLNHPTFQ----TQRLLDRSPSRSAKRKPYHVESS 321

  Fly   352 EAANLRQ------------------QQL------------ASQQFM---LATAA-QQLQTGPAQA 382
            ..:|..|                  |.|            |::.|:   ||.|: ..|.|...||
Human   322 TLSNRNQAGKSTALQSHHRSNSKDIQNLSVGLPRADEGLPANESFLNGNLAGASLSPLHTKTYQA 386

  Fly   383 AAIAAARDKSKTSNTSLPLLPS 404
            ::...:..|..|:| ::|.|.|
Human   387 SSQPGSTSKDLTNN-NIPHLLS 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 126/288 (44%)
Pkinase 50..335 CDD:278497 126/286 (44%)
CDKL5NP_001032420.1 STKc_CDKL5 11..297 CDD:270838 126/288 (44%)
S_TKc 13..297 CDD:214567 126/286 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..349 9/48 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..566 8/27 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 646..834
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D398098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101283
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.