DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and STK4

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_005260587.1 Gene:STK4 / 6789 HGNCID:11408 Length:503 Species:Homo sapiens


Alignment Length:374 Identity:105/374 - (28%)
Similarity:168/374 - (44%) Gaps:76/374 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QSLQNSFLYRLIQKIQVCNEPDLVETRQYRPQGSSKMDR-----YEKLSRLGEGSYGVVYKCRDR 70
            |.|.|. |:.|:..    :|||:  .||.:......:.:     ::.|.:|||||||.|||...:
Human     9 QCLPNG-LHILLSS----SEPDI--GRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHK 66

  Fly    71 ETGALVAVKRF-VESEDDPAIRKIALREIRLLKNLKHPNLVSLLEVFRRKRRLHLVFEFCELTVL 134
            |||.:||:|:. |||:    :::| ::||.:::....|::|.....:.:...|.:|.|:|....:
Human    67 ETGQIVAIKQVPVESD----LQEI-IKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSV 126

  Fly   135 HELER-HPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARMLS 198
            .::.| ..:...|.....|...||.|:.|.|....:|||||..||||..:|..||.|||.|..| 
Human   127 SDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQL- 190

  Fly   199 PGENYTDYVATR-------WYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQL 256
                 ||.:|.|       ::.||| ::.:..|....|:|::|....|:..|:            
Human   191 -----TDTMAKRNTVIGTPFWMAPE-VIQEIGYNCVADIWSLGITAIEMAEGK------------ 237

  Fly   257 YLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPLEDKMPAKSQQNPLTIDFLKKCLDKDPT 321
                       |.:..|......|...|.| |||.     :.|.....|  ..||:|:||.|.|.
Human   238 -----------PPYADIHPMRAIFMIPTNP-PPTF-----RKPELWSDN--FTDFVKQCLVKSPE 283

  Fly   322 KRWSCEKLTKHSYFDDYIAKQRELEHVNSL-----EAANLRQQQLASQQ 365
            :|.:..:|.:|.:.       |..:.|:.|     ||.:::.::..|||
Human   284 QRATATQLLQHPFV-------RSAKGVSILRDLINEAMDVKLKRQESQQ 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 87/300 (29%)
Pkinase 50..335 CDD:278497 87/293 (30%)
STK4XP_005260587.1 STKc_MST1_2 42..297 CDD:132943 87/297 (29%)
S_TKc 46..297 CDD:214567 87/293 (30%)
Mst1_SARAH 449..496 CDD:288481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.