Sequence 1: | NP_608950.3 | Gene: | CG7236 / 33798 | FlyBaseID: | FBgn0031730 | Length: | 438 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001034978.1 | Gene: | Smok3b / 622474 | MGIID: | 3615348 | Length: | 504 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 67/202 - (33%) |
---|---|---|---|
Similarity: | 104/202 - (51%) | Gaps: | 15/202 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 RYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRK------IALREIRLLKNLKHP 107
Fly 108 NLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRD 172
Fly 173 IKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLF 237
Fly 238 AELVRGE 244 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7236 | NP_608950.3 | STKc_CDKL1_4 | 48..335 | CDD:270837 | 67/202 (33%) |
Pkinase | 50..335 | CDD:278497 | 67/201 (33%) | ||
Smok3b | NP_001034978.1 | STKc_AMPK-like | 27..275 | CDD:270905 | 67/202 (33%) |
UBA_MARK_Par1 | 295..334 | CDD:270522 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 389..421 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 441..468 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |