DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and Smok3b

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001034978.1 Gene:Smok3b / 622474 MGIID:3615348 Length:504 Species:Mus musculus


Alignment Length:202 Identity:67/202 - (33%)
Similarity:104/202 - (51%) Gaps:15/202 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRK------IALREIRLLKNLKHP 107
            :|..|..:|.|....|...:.|.||..||||         .|||      ..:.|:.||....||
Mouse    27 QYVMLETIGHGGCATVKLAQHRLTGTHVAVK---------TIRKREYWCNRVISEVELLMMADHP 82

  Fly   108 NLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRD 172
            |::|||:|...|::::|:.|.|:...|::..|......||..:.:..|.|..:.|||.||.:|||
Mouse    83 NIISLLQVIETKKKVYLIMELCKGKSLYQHIRKAGYLQEHEARALFKQLLSAMNYCHNQGIVHRD 147

  Fly   173 IKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLF 237
            :||:||::...|:||:.|||....:.||:....:..|..:.|||:|:.....|..:|||.:|.:.
Mouse   148 LKPDNIMVEKDGKVKIIDFGLGTKVKPGQKLNLFCGTYPFSAPEVLLSTPYDGPKIDVWTLGVVL 212

  Fly   238 AELVRGE 244
            ..:|.|:
Mouse   213 YFMVTGK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 67/202 (33%)
Pkinase 50..335 CDD:278497 67/201 (33%)
Smok3bNP_001034978.1 STKc_AMPK-like 27..275 CDD:270905 67/202 (33%)
UBA_MARK_Par1 295..334 CDD:270522
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..421
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 441..468
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.