DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and TAOK1

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_065842.1 Gene:TAOK1 / 57551 HGNCID:29259 Length:1001 Species:Homo sapiens


Alignment Length:393 Identity:114/393 - (29%)
Similarity:175/393 - (44%) Gaps:71/393 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EPDLVETRQYRPQGSSKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIR-KI 93
            :|::.|.  :..:...|:  :..|..:|.||:|.||..||..|..:||:|:...|......: :.
Human    12 DPEIAEL--FFKEDPEKL--FTDLREIGHGSFGAVYFARDVRTNEVVAIKKMSYSGKQSTEKWQD 72

  Fly    94 ALREIRLLKNLKHPNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLL 158
            .::|::.|:.:||||.:.....:.|:....||.|:|..:....||.|.:...|.....|.:..|.
Human    73 IIKEVKFLQRIKHPNSIEYKGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAITHGALQ 137

  Fly   159 GVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVG--D 221
            |:||.|....:|||||..|||||..|||||.|||.|.|.||..:   :|.|.::.|||:::.  :
Human   138 GLAYLHSHTMIHRDIKAGNILLTEPGQVKLADFGSASMASPANS---FVGTPYWMAPEVILAMDE 199

  Fly   222 TQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLP 286
            .||...||||::|....||...:......:.:..||            ||   .|||        
Human   200 GQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALY------------HI---AQNE-------- 241

  Fly   287 VPPTLEPLEDKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSY---------FDDYIAKQ 342
             .|||:        .::.:....:|:..||.|.|..|.:.|:|.||.:         ..|.|  |
Human   242 -SPTLQ--------SNEWSDYFRNFVDSCLQKIPQDRPTSEELLKHIFVLRERPETVLIDLI--Q 295

  Fly   343 RELEHVNSLEAANLRQQQLASQQFMLATAAQQLQTGPA-QAAAIAAARD---------KSKTSNT 397
            |..:.|..|:  ||:.:::....|      |:...||| :|......:|         .|..||.
Human   296 RTKDAVRELD--NLQYRKMKKLLF------QEAHNGPAVEAQEEEEEQDHGVGRTGTVNSVGSNQ 352

  Fly   398 SLP 400
            |:|
Human   353 SIP 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 91/298 (31%)
Pkinase 50..335 CDD:278497 91/296 (31%)
TAOK1NP_065842.1 STKc_TAO1 2..318 CDD:270805 103/354 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..433 9/32 (28%)
SbcC <442..>877 CDD:223496
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 567..587
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.