DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and SCYL2

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001317182.1 Gene:SCYL2 / 55681 HGNCID:19286 Length:933 Species:Homo sapiens


Alignment Length:335 Identity:70/335 - (20%)
Similarity:122/335 - (36%) Gaps:74/335 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LGEGSYGVVY-------KCRDRETGALVAVKRFVES----EDDPAIRKIALREIRLLKNLKHPNL 109
            :..|..|:.:       |...:|....|..|:.::.    |.|..|..:. |.::.|..|:||.|
Human    38 IASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKLIDKYQKFEKDQIIDSLK-RGVQQLTRLRHPRL 101

  Fly   110 VSLLEVFRRKRRLHLVFEFCE-------LTVLHELERHPQGCPEHL---------TKQICYQTLL 158
            :::.......|.   ...||.       ..||...|..|......:         ||....|...
Human   102 LTVQHPLEESRD---CLAFCTEPVFASLANVLGNWENLPSPISPDIKDYKLYDVETKYGLLQVSE 163

  Fly   159 GVAYCHKQ-GCLHRDIKPENILLTAQGQVKLCDFGF-ARMLSPGENYTDYVATRW---------- 211
            |:::.|.. ..:|.:|.||||:|...|..|:..|.| ....:|.|....:....|          
Human   164 GLSFLHSSVKMVHGNITPENIILNKSGAWKIMGFDFCVSSTNPSEQEPKFPCKEWDPNLPSLCLP 228

  Fly   212 ---YRAPELLVGDTQYGTPVDVWAIG-CLFAELVRGEALWP-GRSDV--------DQLYLIRKTL 263
               |.|||.:: .....|..|::::| .::|...:|:.::. .:.|:        |||..:..:.
Human   229 NPEYLAPEYIL-SVSCETASDMYSLGTVMYAVFNKGKPIFEVNKQDIYKSFSRQLDQLSRLGSSS 292

  Fly   264 GDLLPRHIQIFGQNEYFKGITLPVPPTLEPLED---KMPAKSQQNPLTIDFLKKCLDKDPTKRWS 325
            ...:|..::     |:.| :.|.|.||:.|..|   |:|.......:|:.:......:|      
Human   293 LTNIPEEVR-----EHVK-LLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRD------ 345

  Fly   326 CEKLTKHSYF 335
              .|.|..:|
Human   346 --NLQKSQFF 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 69/333 (21%)
Pkinase 50..335 CDD:278497 69/333 (21%)
SCYL2NP_001317182.1 HEAT 447..483
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 688..713
Necessary for interaction with AP2 complex and clathrin, interaction with clathrin is necessary for its targeting to the TGN and endosomal membranes 703..933
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 910..933
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.