DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and TBC1D22B

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_060242.2 Gene:TBC1D22B / 55633 HGNCID:21602 Length:505 Species:Homo sapiens


Alignment Length:156 Identity:34/156 - (21%)
Similarity:57/156 - (36%) Gaps:41/156 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 KMPAKSQ-----QNP-----LTIDFLKK--CLDKDPTKRWSCEKLTKHSYFDDYIAKQRELEHVN 349
            |:|...|     |:|     ||.:|:|:  .::..|.|.      .|.|.|.::.....:...:.
Human    15 KLPGSIQPVYGAQHPPLDPRLTKNFIKERSKVNTVPLKN------KKASSFHEFARNTSDAWDIG 73

  Fly   350 SLEAANLRQQ--QLASQQFMLATAAQQLQTG-----------------PAQAAAIAAARDKSKTS 395
            ..|..:....  |..:.:..||||||.|:..                 ||....|.::.|...:.
Human    74 DDEEEDFSSPSFQTLNSKVALATAAQVLENHSKLRVKPERSQSTTSDVPANYKVIKSSSDAQLSR 138

  Fly   396 NTSLPLLPSTQHHHHPHQDYVKLQPL 421
            |:|...|.:..|    .|..:.|:|:
Human   139 NSSDTCLRNPLH----KQQSLPLRPI 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 13/49 (27%)
Pkinase 50..335 CDD:278497 13/49 (27%)
TBC1D22BNP_060242.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 105..146 6/40 (15%)
TBC 207..457 CDD:214540
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.