DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and cdk10

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001017622.2 Gene:cdk10 / 550285 ZFINID:ZDB-GENE-050417-94 Length:360 Species:Danio rerio


Alignment Length:341 Identity:116/341 - (34%)
Similarity:165/341 - (48%) Gaps:47/341 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVSLLE 114
            :||::|:|||:||:||:.||..|..:||:|:....::...|...:||||.||..|:|||:|.|.|
Zfish    40 FEKINRIGEGTYGIVYRARDTRTNEIVALKKVRMDKEKDGIPISSLREINLLIRLRHPNIVELKE 104

  Fly   115 VF--RRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPEN 177
            |.  .....|.||..:||..:...||.......|...|.|..|.|.|:||.|....||||:|..|
Zfish   105 VVVGSHLESLFLVMSYCEQDLASLLENMQSPFSEAQVKCIVLQLLKGLAYLHHNFILHRDLKVSN 169

  Fly   178 ILLTAQGQVKLCDFGFARMLS-PGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELV 241
            :|:|.:|.||:.|||.||:.. |.:..|..|.|.||||||||:|.....|.:|:||:||:||||:
Zfish   170 LLMTDKGCVKIADFGLARVYGIPLQPMTPRVVTLWYRAPELLLGTKTQTTALDMWAVGCIFAELL 234

  Fly   242 RGEALWPGRSDVDQLYLIRKTLG----DLLP--RHIQIFGQNEYFKGITLPVPPTLEPLEDKMPA 300
            ..:.|.||.|::.||.||.:.||    .:.|  ..:.:.||...                .|.|.
Zfish   235 AHKPLLPGASEIQQLDLIVQLLGTPNESIWPGFSRLPLVGQYSL----------------RKQPY 283

  Fly   301 KSQQNPLT------IDFLKKCLDKDPTKRWSCEKLTKHSYFDDYIAKQREL-----------EHV 348
            .:.:|..|      :..|......:|.:|.:.....:.|||     |::.|           .|.
Zfish   284 NNLKNKFTWLSEAGLRLLNLLFMYNPQRRATAIDCLESSYF-----KEKPLPCEPELMPTFPHHR 343

  Fly   349 NSLEAANLRQQQLASQ 364
            |...|:....|...|:
Zfish   344 NKRSASETEHQTKRSK 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 107/299 (36%)
Pkinase 50..335 CDD:278497 107/299 (36%)
cdk10NP_001017622.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.