DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and Cdkl2

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_058608.1 Gene:Cdkl2 / 53886 MGIID:1858227 Length:568 Species:Mus musculus


Alignment Length:315 Identity:158/315 - (50%)
Similarity:219/315 - (69%) Gaps:9/315 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVS 111
            |::||.|..:||||||:|.|||::::|.:||:|:|:||:||..::|||:|||:|||.|:|.|||:
Mouse     1 MEKYENLGLVGEGSYGMVMKCRNKDSGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRHENLVN 65

  Fly   112 LLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPE 176
            ||||.::|:|.:|||||.:.|:|.:|:..|.|....:.::..:|.:.|:.:||....:|||||||
Mouse    66 LLEVCKKKKRWYLVFEFVDHTILDDLKLFPNGLDYQVVQKYLFQIINGIGFCHSHNIIHRDIKPE 130

  Fly   177 NILLTAQGQVKLCDFGFARML-SPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAEL 240
            |||::..|.||||||||||.| :|||.|||||||||||||||||||.:||..||:||||||..|:
Mouse   131 NILVSQSGVVKLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYGKAVDIWAIGCLVIEM 195

  Fly   241 VRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLP--VPPTLEPLEDKMPAKSQ 303
            :.|:.|:||.||:|||:.|...||:|:|||.::|.:|..|.|:.||  .....||||.:.|...:
Mouse   196 LMGQPLFPGESDIDQLHHIMTCLGNLIPRHQELFYKNPVFAGVRLPEVKDAEAEPLESRYPKLPE 260

  Fly   304 QNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFD-DYIAKQ--RELEHVNSLEAAN 355
               ..|...||||..||.||..|..|.:|.:|. |..|::  :||:.....:|.|
Mouse   261 ---AVISLAKKCLHIDPDKRPFCADLLRHDFFQMDGFAERFSQELQLKIEKDARN 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 150/289 (52%)
Pkinase 50..335 CDD:278497 150/287 (52%)
Cdkl2NP_058608.1 STKc_CDKL2_3 2..289 CDD:270836 150/289 (52%)
[NKR]KIAxRE 45..51 3/5 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..333 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D398098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101283
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.