DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and WEE2

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001099028.1 Gene:WEE2 / 494551 HGNCID:19684 Length:567 Species:Homo sapiens


Alignment Length:478 Identity:105/478 - (21%)
Similarity:160/478 - (33%) Gaps:153/478 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YLPQSLQNSFLY----RLIQKIQVCNEPDLVETRQYRPQG-----------SSKMDRYEK----L 53
            :.|:|.:..||.    |.|:       .||.|......:|           ::...||||    :
Human   158 FTPESYKKLFLQSGGKRKIR-------GDLEEAGPEEGKGGLPAKRCVLRETNMASRYEKEFLEV 215

  Fly    54 SRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNL-KHPNLVSLLEVFR 117
            .::|.|.:|.||||..|..|.:.|:||.:::..:.:....||.|:.....| .||::|.....:.
Human   216 EKIGVGEFGTVYKCIKRLDGCVYAIKRSMKTFTELSNENSALHEVYAHAVLGHHPHVVRYYSSWA 280

  Fly   118 RKRRLHLVFEFCE----LTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPENI 178
            ....:.:..|:|.    ...:.|..:......|...|.|..|..||:.|.|....:|.||||.||
Human   281 EDDHMIIQNEYCNGGSLQAAISENTKSGNHFEEPKLKDILLQISLGLNYIHNSSMVHLDIKPSNI 345

  Fly   179 -----------------------LLTAQGQVKLCDFGFARMLS-----PGENYTDYVATRWYRAP 215
                                   .|:|....|:.|.|.|..::     .|::.        :.|.
Human   346 FICHKMQSESSGVIEEVENEADWFLSANVMYKIGDLGHATSINKPKVEEGDSR--------FLAN 402

  Fly   216 ELLVGDTQYGTPVDVWAIGCLFAELVRGEAL------WPGRSDVDQLYLIRKTLGDLLPRHIQIF 274
            |:|..|.::....|::|:|...|.....|:|      |                     .||:  
Human   403 EILQEDYRHLPKADIFALGLTIAVAAGAESLPTNGAAW---------------------HHIR-- 444

  Fly   275 GQNEYFKGITLPVPPTLEPLEDKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDDYI 339
                  ||....||..|......:             ||..:..|..:|.|...|.:::.....:
Human   445 ------KGNFPDVPQELSESFSSL-------------LKNMIQPDAEQRPSAAALARNTVLRPSL 490

  Fly   340 AKQRELEHVNSLEAANLRQQQLASQQFMLAT------AAQQLQ-----------------TGPAQ 381
            .|..||            ||||..::|..||      .|||.|                 ||...
Human   491 GKTEEL------------QQQLNLEKFKTATLERELREAQQAQSPQGYTHHGDTGVSGTHTGSRS 543

  Fly   382 AAAIA---AARDKSKTSNTSLPL 401
            ...:.   :||..|.||....||
Human   544 TKRLVGGKSARSSSFTSGEREPL 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 72/329 (22%)
Pkinase 50..335 CDD:278497 71/327 (22%)
WEE2NP_001099028.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..117
Nuclear localization signal. /evidence=ECO:0000250 173..175 0/1 (0%)
PTKc_Wee1b 211..485 CDD:271041 68/323 (21%)
Pkinase 212..480 CDD:278497 67/317 (21%)
Nuclear export signal. /evidence=ECO:0000250 315..329 5/13 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 514..567 13/53 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.