DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and Doa

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001014681.2 Gene:Doa / 43415 FlyBaseID:FBgn0265998 Length:2045 Species:Drosophila melanogaster


Alignment Length:333 Identity:89/333 - (26%)
Similarity:149/333 - (44%) Gaps:55/333 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNL--KHPN--- 108
            ||:.::.||||::|.|.|.:|.|....:|:|.....|   ..|:.|..||..|:.:  |.|:   
  Fly  1691 RYKIMATLGEGTFGRVVKVKDMERDYCMALKIIKNVE---KYREAAKLEINALEKIAQKDPHCDH 1752

  Fly   109 -LVSLLEVFRRKRRLHLVFEFCELTVL-----HELERHPQGCPEHLTKQICYQTLLGVAYCHKQG 167
             .|.:::.|.....:.:|||...|:|.     :..|.:|.....|:..|:||    .|.:.|...
  Fly  1753 LCVKMIDWFDYHGHMCIVFEMLGLSVFDFLRENNYEPYPLDQVRHMAYQLCY----SVKFLHDNR 1813

  Fly   168 CLHRDIKPENILL-------------------TAQGQVKLCDFGFARMLSPGENYTDYVATRWYR 213
            ..|.|:||||||.                   .....|:|.|||.|..  ..|:::..|:||.||
  Fly  1814 LTHTDLKPENILFVDSDYTSHYNHKINREVRRVKNTDVRLIDFGSATF--DHEHHSTIVSTRHYR 1876

  Fly   214 APELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDL---LPRHIQIFG 275
            |||::: :..:..|.|||:|||:..||..|..|:....:.:.|.::.:.||.:   :.|:..::.
  Fly  1877 APEVIL-ELGWSQPCDVWSIGCILFELYLGITLFQTHDNREHLAMMERILGQIPYRMARNHTLYS 1940

  Fly   276 --QNEYFKGITLP----------VPPTLEPLEDKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEK 328
              :.:||....|.          |....:||.....:.|:.:......:||.|:.:|:.|.:..:
  Fly  1941 KTKTKYFYHGKLDWDEKSSAGRYVRDHCKPLFLCQLSDSEDHCELFSLIKKMLEYEPSSRITLGE 2005

  Fly   329 LTKHSYFD 336
            ...|.:||
  Fly  2006 ALHHPFFD 2013

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 87/330 (26%)
Pkinase 50..335 CDD:278497 86/329 (26%)
DoaNP_001014681.2 PKc_CLK 1679..2012 CDD:271036 87/330 (26%)
S_TKc 1692..2012 CDD:214567 86/329 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.