DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and Cdk2

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster


Alignment Length:311 Identity:108/311 - (34%)
Similarity:168/311 - (54%) Gaps:29/311 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVS 111
            :|.:::..::|||:||:|||.|...||..||:|:.....:...:...|:|||.|||||||||:|.
  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69

  Fly   112 LLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPE 176
            |.:|......|:::||:..:.:...:::........|.|...:|.|..|.:||....||||:||:
  Fly    70 LFDVVISGNNLYMIFEYLNMDLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLKPQ 134

  Fly   177 NILLTAQGQVKLCDFGFARMLS-PGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAEL 240
            |:|:...|::||.|||.||..: |...||..|.|.||||||:|:|...|.|.||:|::||:|:|:
  Fly   135 NLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFSEM 199

  Fly   241 VRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPLEDKMP---AKS 302
            :...:|:||.|::||||.|.:||..         .....:.|:|     .|...:.|.|   ..:
  Fly   200 IMRRSLFPGDSEIDQLYRIFRTLST---------PDETNWPGVT-----QLPDFKTKFPRWEGTN 250

  Fly   303 QQNPLT----IDFLKKCLDKDPTKRWSCEKLTKHSYFDDYIAKQRELEHVN 349
            ...|:|    .:.:...|..||..|.|.:...:|:||       |.::||:
  Fly   251 MPQPITEHEAHELIMSMLCYDPNLRISAKDALQHAYF-------RNVQHVD 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 103/294 (35%)
Pkinase 50..335 CDD:278497 102/292 (35%)
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 106/308 (34%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 102/292 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442464
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.