DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and MAK

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001229886.1 Gene:MAK / 4117 HGNCID:6816 Length:648 Species:Homo sapiens


Alignment Length:413 Identity:135/413 - (32%)
Similarity:205/413 - (49%) Gaps:50/413 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVE---SEDDPAIRKIALREIRLLKNLKHPN 108
            |:||..:.:||:|:||.|...:..|:|.|||:||...   |.|:    .:.|||::.||.|.|.|
Human     1 MNRYTTMRQLGDGTYGSVLMGKSNESGELVAIKRMKRKFYSWDE----CMNLREVKSLKKLNHAN 61

  Fly   109 LVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDI 173
            ::.|.||.|....|:.:||:.:..:...::...:..||.:.:.|.||.|.|:|:.||.|..|||:
Human    62 VIKLKEVIRENDHLYFIFEYMKENLYQLMKDRNKLFPESVIRNIMYQILQGLAFIHKHGFFHRDM 126

  Fly   174 KPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFA 238
            ||||:|......||:.|||.||.|.....|||||:||||||||:|:..:.|.:|:||||:|.:.|
Human   127 KPENLLCMGPELVKIADFGLARELRSQPPYTDYVSTRWYRAPEVLLRSSVYSSPIDVWAVGSIMA 191

  Fly   239 ELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLP----------VPPTLEP 293
            ||.....|:||.|:||:::.|.:.||  .|:      ::::.:|..|.          ||..|:.
Human   192 ELYMLRPLFPGTSEVDEIFKICQVLG--TPK------KSDWPEGYQLASSMNFRFPQCVPINLKT 248

  Fly   294 LEDKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDDYIAKQRELEHVNSLEAANLRQ 358
            |   :|..|.:   .|..:.:.|:.||.||.:..:..||.||...........|:.|.::.|.:.
Human   249 L---IPNASNE---AIQLMTEMLNWDPKKRPTASQALKHPYFQVGQVLGPSSNHLESKQSLNKQL 307

  Fly   359 QQLASQQFMLATAAQQLQTGPAQAAAIAAARDKSKTS-----------NTSLPLLPSTQHHHHPH 412
            |.|.|:..::....:.|.....|    ...:.:.|||           |.|:...|..|....|.
Human   308 QPLESKPSLVEVEPKPLPDIIDQ----VVGQPQPKTSQQPLQPIQPPQNLSVQQPPKQQSQEKPP 368

  Fly   413 Q----DYVKLQPLNKNANLLHRT 431
            |    ..||..|...|..|.|::
Human   369 QTLFPSIVKNMPTKPNGTLSHKS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 109/299 (36%)
Pkinase 50..335 CDD:278497 108/297 (36%)
MAKNP_001229886.1 STKc_MAK_like 4..284 CDD:270824 108/297 (36%)
S_TKc 4..284 CDD:214567 108/297 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.