DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and cdk2

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_998571.1 Gene:cdk2 / 406715 ZFINID:ZDB-GENE-040426-2741 Length:298 Species:Danio rerio


Alignment Length:307 Identity:119/307 - (38%)
Similarity:174/307 - (56%) Gaps:35/307 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVS 111
            |:.::|:.::|||:||||||.:::.||..||:|:.....:...:...|:|||.|||.|.|||:|.
Zfish     1 MESFQKVEKIGEGTYGVVYKAKNKVTGETVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVK 65

  Fly   112 LLEVFRRKRRLHLVFEFCELTVLH-ELER-----HPQGCPEHLTKQICYQTLLGVAYCHKQGCLH 170
            |.:|...:.:|:|||||     || :|:|     ...|....|.|...:|.|.|:|:||....||
Zfish    66 LRDVIHTENKLYLVFEF-----LHQDLKRFMDSTSVSGISLPLVKSYLFQLLQGLAFCHSHRVLH 125

  Fly   171 RDIKPENILLTAQGQVKLCDFGFARMLS-PGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIG 234
            ||:||:|:|:.|||::||.|||.||... |...||..|.|.||||||:|:|...|.|.||:|::|
Zfish   126 RDLKPQNLLINAQGEIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLG 190

  Fly   235 CLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPLEDKMP 299
            |:|||::...||:||.|::|||:.|.:|||.         .....:.|:|     ::...:...|
Zfish   191 CIFAEMITRRALFPGDSEIDQLFRIFRTLGT---------PDESIWPGVT-----SMPDYKPSFP 241

  Fly   300 AKSQQN------PLT---IDFLKKCLDKDPTKRWSCEKLTKHSYFDD 337
            ..::|:      ||.   .|.|.:.|..||.||.|.:....|.:|.|
Zfish   242 KWARQDLSKVVPPLDEDGRDLLGQMLTYDPNKRISAKNALVHRFFRD 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 116/302 (38%)
Pkinase 50..335 CDD:278497 116/300 (39%)
cdk2NP_998571.1 PLN00009 1..291 CDD:177649 119/307 (39%)
STKc_CDK2_3 3..286 CDD:270844 116/301 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.