DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and Cdk12

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001262167.1 Gene:Cdk12 / 40385 FlyBaseID:FBgn0037093 Length:1157 Species:Drosophila melanogaster


Alignment Length:396 Identity:125/396 - (31%)
Similarity:187/396 - (47%) Gaps:70/396 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QKIQVCNEPDLVETRQYRPQGSSKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDD 87
            |:..:.|..|  .....|..|...:|.:|.::::|||:||.|||.||..|..:||:|:.....:.
  Fly   779 QRPVILNRRD--SRNNVRDWGERCVDVFEMIAQIGEGTYGQVYKARDHHTNDMVALKKVRLEHEK 841

  Fly    88 PAIRKIALREIRLLKNLKHPNLVSLLEV---------FRR-KRRLHLVFEFCELTVLHELERHPQ 142
            ......|:|||::|:.|.|.|:|:|.|:         ||: |...:||||:.:..::..||....
  Fly   842 EGFPITAVREIKILRQLNHRNIVNLHEIVTDKQDAVEFRKDKGSFYLVFEYMDHDLMGLLESGMV 906

  Fly   143 GCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGEN---YT 204
            ...|.....|..|.|.|:.||||:..||||||..|||:..:|:|||.|||.||:.:..:.   ||
  Fly   907 DFNEENNASIMKQLLDGLNYCHKKNFLHRDIKCSNILMNNRGKVKLADFGLARLYNADDRERPYT 971

  Fly   205 DYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPR 269
            :.|.|.|||.||||:|:.:||..:|||:.||:..||.....|:...:::.||..|.|..|..:|.
  Fly   972 NKVITLWYRPPELLLGEERYGPSIDVWSCGCILGELFVKRPLFQANAEMAQLETISKICGSPVPA 1036

  Fly   270 HIQIFGQNEYFKGITLPVPPTLEPLE----------DKMPAKSQQNPLTIDFLKKCLDKDPTKRW 324
                    .:...|.||:..||:..:          :.|||.:      :|.|.|.||.||.||.
  Fly  1037 --------VWPNVIKLPLFHTLKQKKTHRRRLREDFEFMPAPA------LDLLDKMLDLDPDKRI 1087

  Fly   325 SCEKLTKHSYFDDYIAKQRELEHVNSLEA---------------ANLRQQQLASQQFML------ 368
            :.|...:..:          |..:|..|.               :..|::|:..||..|      
  Fly  1088 TAEDALRSPW----------LRKINPDEMPTPQLPTWQDCHELWSKKRRRQMREQQESLPPTVIA 1142

  Fly   369 ATAAQQ 374
            :|..||
  Fly  1143 STKYQQ 1148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 109/309 (35%)
Pkinase 50..335 CDD:278497 108/307 (35%)
Cdk12NP_001262167.1 STKc_CDK12 796..1098 CDD:270847 110/325 (34%)
S_TKc 804..1098 CDD:214567 108/317 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.