DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and mapk3

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_958915.1 Gene:mapk3 / 399480 ZFINID:ZDB-GENE-040121-1 Length:392 Species:Danio rerio


Alignment Length:306 Identity:101/306 - (33%)
Similarity:160/306 - (52%) Gaps:29/306 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVSLL 113
            ||..|..:|||:||:|....|......||:|:....|.....:: .||||::|....|.|::.:.
Zfish    55 RYTDLQYIGEGAYGMVCSAFDNVNKIRVAIKKISPFEHQTYCQR-TLREIKILLRFHHENIIGIN 118

  Fly   114 EVFRRK-----RRLHLVFEFCELTVLHELERHPQGCPEHLTKQIC---YQTLLGVAYCHKQGCLH 170
            ::.|.:     |.:::|.:..| |.|::|.:..|...:|    ||   ||.|.|:.|.|....||
Zfish   119 DILRARHIDYMRDVYIVQDLME-TDLYKLLKTQQLSNDH----ICYFLYQILRGLKYIHSANVLH 178

  Fly   171 RDIKPENILLTAQGQVKLCDFGFARMLSPGENY----TDYVATRWYRAPELLVGDTQYGTPVDVW 231
            ||:||.|:|:.....:|:||||.||:..|..::    |:|||||||||||:::....|...:|:|
Zfish   179 RDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIW 243

  Fly   232 AIGCLFAELVRGEALWPGRSDVDQLYLIRKTLG----DLLPRHIQIFGQNEYFKGITLPVPPTLE 292
            ::||:.||::....::||:..:|||..|...||    |.|...|.:..:| |.:  :||..|.: 
Zfish   244 SVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSQDDLNCIINMKARN-YLQ--SLPQKPKI- 304

  Fly   293 PLEDKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDDY 338
            |.....|....:   .:|.|.:.|..:|.||.:.|:...|.|.:.|
Zfish   305 PWNKLFPKADNK---ALDLLDRMLTFNPLKRINVEQALAHPYLEQY 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 99/301 (33%)
Pkinase 50..335 CDD:278497 98/300 (33%)
mapk3NP_958915.1 STKc_ERK1_2_like 50..384 CDD:270839 101/306 (33%)
S_TKc 56..344 CDD:214567 98/300 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.