DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and Cdk9

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster


Alignment Length:363 Identity:118/363 - (32%)
Similarity:177/363 - (48%) Gaps:49/363 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DRYEKLSRLGEGSYGVVYKCRDRE-TGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVS 111
            ::|||::::|:|::|.|:|.|::: ....||:|:.:...:.......||||||:|:.|||.|:|:
  Fly    48 NKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRILQLLKHENVVN 112

  Fly   112 LLEVFRRK--------RRLHLVFEFCELTVLHELERHPQGCPEHLT--------KQICYQTLLGV 160
            |:|:.|.|        ...:|||:|||    |:|    .|...::.        |::..|.|.|:
  Fly   113 LIEICRTKATATNGYRSTFYLVFDFCE----HDL----AGLLSNMNVKFSLGEIKKVMQQLLNGL 169

  Fly   161 AYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGEN-----YTDYVATRWYRAPELLVG 220
            .|.|....||||:|..|:|:|..|.:||.|||.||..|..:|     ||:.|.|.|||.||||:|
  Fly   170 YYIHSNKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLG 234

  Fly   221 DTQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITL 285
            |..||.|||:|..||:.||:.....:..|.::..||..|.:..|...|.......:.|.:|.|.|
  Fly   235 DRNYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIEL 299

  Fly   286 PVPPTLEPLEDKMPAKSQQNPLT-----IDFLKKCLDKDPTKRWSCEKLTKHSYF--DDYIAKQR 343
                   |...|...|.:..|..     .|.|.|.|..||.||...:....|.:|  |...:...
  Fly   300 -------PKNQKRRVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPSDLS 357

  Fly   344 EL--EHVNSL---EAANLRQQQLASQQFMLATAAQQLQ 376
            ::  :|:.|:   .|...|..|:.:....|.|..|:.|
  Fly   358 KMLSQHLQSMFEYLAQPRRSNQMRNYHQQLTTMNQKPQ 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 107/313 (34%)
Pkinase 50..335 CDD:278497 107/311 (34%)
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 107/313 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442451
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.