DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and Cdc2rk

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster


Alignment Length:300 Identity:111/300 - (37%)
Similarity:159/300 - (53%) Gaps:19/300 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVS 111
            :..:|||:|:||||||:||:.||..:..:||:|:....::...:....||||.:||...|.|:|.
  Fly    50 VSEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHENIVR 114

  Fly   112 LLEVFRRKR--RLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIK 174
            |.||...|.  .:.||.:|||..:...|:...|...|...|.|..|.|..:.|.|.:..:|||:|
  Fly   115 LREVVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLK 179

  Fly   175 PENILLTAQGQVKLCDFGFARMLS-PGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFA 238
            ..|:|:|.:|.:|:.|||.|||.| |.:..|..:.|.||||||||:|...:.|.||:||.||:..
  Fly   180 VSNLLMTDKGCIKVADFGLARMFSNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILG 244

  Fly   239 ELVRGEALWPGRSDVDQLYLIRKTLG----DLLPRHIQIFGQNEYFKGITLPVPP--TLEPLEDK 297
            ||:.|:.|.||.|::.||.:|...||    .:.|.    |......:..||...|  .|.| :..
  Fly   245 ELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPG----FADLPAVQNFTLSQQPYNNLTP-KFH 304

  Fly   298 MPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDD 337
            |..:|.:|.|.|.|:     .:|..|.:.|:..|..||.|
  Fly   305 MIGQSGRNLLNILFI-----YNPKTRATAEECLKSKYFVD 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 108/295 (37%)
Pkinase 50..335 CDD:278497 108/293 (37%)
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 110/299 (37%)
S_TKc 53..337 CDD:214567 108/293 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442427
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.