DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and max-2

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001300485.1 Gene:max-2 / 3565400 WormBaseID:WBGene00003144 Length:649 Species:Caenorhabditis elegans


Alignment Length:317 Identity:84/317 - (26%)
Similarity:144/317 - (45%) Gaps:57/317 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SSKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPN 108
            |:.:.:||...::|.|:.|.|:......:..:||||| :..:..|. :::.|.||:::|..:|||
 Worm   373 SNPLGKYEMKKQIGVGASGTVFVANVAGSTDVVAVKR-MAFKTQPK-KEMLLTEIKVMKQYRHPN 435

  Fly   109 LVSLLEVFR-RKRRLHLVFEFCE------LTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQ 166
            ||:.:|.:. ....|.:|.::.|      :.|..||:       |.....:..:.|..:.:.|:.
 Worm   436 LVNYIESYLVDADDLWVVMDYLEGGNLTDVVVKTELD-------EGQIAAVLQECLKALHFLHRH 493

  Fly   167 GCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDVW 231
            ..:|||||.:|:||...|:|||.|.||...:.||......|.|.::.:||:| ...||...||:|
 Worm   494 SIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPGSKRDTVVGTPYWMSPEIL-NKKQYNYKVDIW 557

  Fly   232 AIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPLED 296
            ::|.:..|::.||..:...:.:..:|||.:.            |:.|               ::.
 Worm   558 SLGIMALEMIDGEPPYLRETPLKAIYLIAQN------------GKPE---------------IKQ 595

  Fly   297 KMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFD---------DYIAKQRE 344
            :....|:.|    :||.|||..||.:|....:|..|.:..         .||...||
 Worm   596 RDRLSSEFN----NFLDKCLVVDPDQRADTTELLAHPFLKKAKPLSSLIPYIRAVRE 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 79/293 (27%)
Pkinase 50..335 CDD:278497 79/291 (27%)
max-2NP_001300485.1 STKc_PAK 378..631 CDD:270789 79/293 (27%)
S_TKc 379..630 CDD:214567 79/291 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.