DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and Pk34A

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_609603.1 Gene:Pk34A / 34705 FlyBaseID:FBgn0028410 Length:392 Species:Drosophila melanogaster


Alignment Length:348 Identity:104/348 - (29%)
Similarity:148/348 - (42%) Gaps:84/348 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QVCNEPDLVETRQYRPQGSSKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAI 90
            ::|:||.||              |.|....:|.||:|.||:....|:..:||||:.:.:.     
  Fly    34 RLCSEPALV--------------RIEVKDLIGSGSFGRVYQAHVNESEEIVAVKQTLYNP----- 79

  Fly    91 RKIALREIRLLKNLK-HPNLVSLLEVFRRKRRLH--------------LVFEFCELTVLHELERH 140
             |::..|..::..|| |.|:|.|:        :|              ||.|:..:|:|..:..|
  Fly    80 -KLSQGEAEIMGQLKDHNNIVRLI--------MHSSVSLGFPSVDYVLLVMEYMPMTLLDYINYH 135

  Fly   141 -----PQGCPEHL--TKQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQGQV-KLCDFGFARML 197
                 |   .|.|  .:.:.||...|:.|.|..|..|||:||||:|:..|..| ||.|||.|::|
  Fly   136 LTVLQP---AERLINVRILSYQMFRGLGYLHLLGISHRDVKPENLLIDNQKMVLKLSDFGSAKLL 197

  Fly   198 SPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPG-RSDVDQLYLIRK 261
            .|.|....|:.:|.||||||..|...|...||:|:.||:.|||::|..|:.. :.|..||.||..
  Fly   198 VPQEPSISYICSRLYRAPELFAGYELYSCAVDIWSAGCVLAELLKGYPLFSSHKHDRKQLRLIVN 262

  Fly   262 TLG-DLLPRHIQIFGQ--NEYFKGITLP---------VPPTLEPLEDKMPAKSQQNPLTIDFLKK 314
            .|| |.|.|..:|..:  |......|.|         ||..|                 ...|..
  Fly   263 MLGTDGLERAPEILSKCGNSLHPRTTRPSWNYLLNTAVPQDL-----------------CGLLNS 310

  Fly   315 CLDKDPTKRWSCEKLTKHSYFDD 337
            |...:...|.|......|..:|:
  Fly   311 CFIYEAAARISPMMACSHGSYDE 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 98/322 (30%)
Pkinase 50..335 CDD:278497 97/320 (30%)
Pk34ANP_609603.1 STKc_GSK3 39..334 CDD:271039 102/343 (30%)
S_TKc 45..328 CDD:214567 96/316 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442381
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.