DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and NEK5

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001352481.1 Gene:NEK5 / 341676 HGNCID:7748 Length:832 Species:Homo sapiens


Alignment Length:400 Identity:97/400 - (24%)
Similarity:160/400 - (40%) Gaps:76/400 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIA-LREIRLLKNLKHPNLV 110
            ||:|:.:..:|:|::|..|..:.:.......:|. :..|..|...|.| .:|:.||:.:||||:|
Human     1 MDKYDVIKAIGQGAFGKAYLAKGKSDSKHCVIKE-INFEKMPIQEKEASKKEVILLEKMKHPNIV 64

  Fly   111 SLLEVFRRKRRLHLVFEFCELTVLHELERHPQGC--PEHLTKQICYQTLLGVAYCHKQGCLHRDI 173
            :....|:...||.:|.|:|:...|.:.....:|.  .|........|..||:.:.|.:..|||||
Human    65 AFFNSFQENGRLFIVMEYCDGGDLMKRINRQRGVLFSEDQILGWFVQISLGLKHIHDRKILHRDI 129

  Fly   174 KPENILLTAQGQV-KLCDFGFARMLSPG-ENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCL 236
            |.:||.|:..|.| ||.|||.||:|:.. |.....:.|.:|.:|| :..:..|....|:|::||:
Human   130 KAQNIFLSKNGMVAKLGDFGIARVLNNSMELARTCIGTPYYLSPE-ICQNKPYNNKTDIWSLGCV 193

  Fly   237 FAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPP----TLEPLEDK 297
            ..||...:..:.| :::.||.|      .:...|.             .|:.|    .|..|   
Human   194 LYELCTLKHPFEG-NNLQQLVL------KICQAHF-------------APISPGFSRELHSL--- 235

  Fly   298 MPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDDYIAKQRELEHVNSLEAANLRQQQLA 362
                          :.:.....|..|.|...:.|..:.::.|.|....|.:         |::.:
Human   236 --------------ISQLFQVSPRDRPSINSILKRPFLENLIPKYLTPEVI---------QEEFS 277

  Fly   363 SQQFMLATAAQQLQTGP-AQAAAIAAARDKSKTSNTSLPLLPSTQHHHHPHQDYVKLQPLNKNAN 426
            ......|.|......|. .|...|...|.:.|.                |.:..:.: |:.:|| 
Human   278 HMLICRAGAPASRHAGKVVQKCKIQKVRFQGKC----------------PPRSRISV-PIKRNA- 324

  Fly   427 LLHRTEHHLP 436
            :|||.|...|
Human   325 ILHRNEWRPP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 76/295 (26%)
Pkinase 50..335 CDD:278497 75/293 (26%)
NEK5NP_001352481.1 STKc_Nek5 3..259 CDD:173765 75/294 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.