DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and Wee1

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001260167.1 Gene:Wee1 / 33965 FlyBaseID:FBgn0011737 Length:609 Species:Drosophila melanogaster


Alignment Length:327 Identity:78/327 - (23%)
Similarity:127/327 - (38%) Gaps:71/327 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ETRQYRPQ----GSSKMDRYEK----LSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIR 91
            |..|..|:    ..:.:.|:::    ::.:|.|.:|||::|.:|..|.:.|:|:..:.....:..
  Fly   216 EIHQQAPKRLALHDTNISRFKREFMQVNVIGVGEFGVVFQCVNRLDGCIYAIKKSKKPVAGSSFE 280

  Fly    92 KIALREIRLLKNL-KHPNLVSLLEVFRRKRRLHLVFEFCELTVLH-ELERHPQGCPEHLTKQICY 154
            |.||.|:.....| ||.|:|.....:.....:.:..|||:...|| .::.|..|  |...|.:..
  Fly   281 KRALNEVWAHAVLGKHDNVVRYYSAWAEDDHMLIQNEFCDGGSLHARIQDHCLG--EAELKIVLM 343

  Fly   155 QTLLGVAYCHKQGCLHRDIKPENI----------LLTAQGQVKLCDFGFARM---LSPGENYTDY 206
            ..:.|:.|.|....:|.|:|||||          |:..|.|....|.|...:   |...||...|
  Fly   344 HVIEGLRYIHSNDLVHMDLKPENIFSTMNPNAHKLVEVQPQQTKDDDGMDSVYEELRHSENLVTY 408

  Fly   207 VATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHI 271
                       .:||..:.|.|..                 |...:.|..||.::.|.:   .:.
  Fly   409 -----------KIGDLGHVTSVKE-----------------PYVEEGDCRYLPKEILHE---DYS 442

  Fly   272 QIFGQNEYFKGITL-------PVP---PTLEPLEDK----MPAKSQQ-NPLTIDFLKKCLDKDPT 321
            .:|..:.:..||||       |:|   |....|.|.    :|:.|:. |.|....:....||.||
  Fly   443 NLFKADIFSLGITLFEAAGGGPLPKNGPEWHNLRDGKVPILPSLSRDFNELIAQMMHPYPDKRPT 507

  Fly   322 KR 323
            .:
  Fly   508 SQ 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 75/310 (24%)
Pkinase 50..335 CDD:278497 74/308 (24%)
Wee1NP_001260167.1 PTKc_Wee1 238..516 CDD:270953 74/305 (24%)
Pkinase 239..515 CDD:278497 74/304 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.