DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and Pkmyt1

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001099236.1 Gene:Pkmyt1 / 287101 RGDID:1305434 Length:490 Species:Rattus norvegicus


Alignment Length:303 Identity:94/303 - (31%)
Similarity:132/303 - (43%) Gaps:36/303 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PQSLQNSFLYRLIQKIQVCNEPDLVETRQY---RPQGSSKMDRYEKLSRLGEGSYGVVYKCRDRE 71
            ||..:.|||         |...:.:::..|   ||: |.....:::|||||.||||.|:|.|.:|
  Rat    68 PQPRRVSFL---------CETSETLQSPGYDPSRPE-SFFQQNFQRLSRLGHGSYGEVFKVRSKE 122

  Fly    72 TGALVAVKRFVESEDDPAIRKIALREIRLLKNL-KHPNLVSLLEVFRRKRRLHLVFEFCELTVLH 135
            .|.|.||||.:.....|..|...|.|:...:.: :||:.|.|...:.....|:|..|.|..::..
  Rat   123 DGRLYAVKRSMSPFRGPKDRTRKLAEVGGHEKVGQHPHCVRLERAWEEGGILYLQTELCGPSLQQ 187

  Fly   136 ELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFG-FARMLSP 199
            ..|......||.........|||.:.:.|.||.:|.|:||.||.|..:|:.||.||| ...:.|.
  Rat   188 HCEAWGASLPEAQVWGYLRDTLLALDHLHSQGLVHLDVKPANIFLGPRGRCKLGDFGLLVELGSA 252

  Fly   200 GENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQL---YL--- 258
            |.........| |.|||||.|  .|||..||:::|....|:.....|..|.....||   ||   
  Rat   253 GAGEAQEGDPR-YMAPELLRG--SYGTAADVFSLGLTILEVACNMELPHGGEGWQQLRQGYLPPE 314

  Fly   259 --------IRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEP 293
                    :|..|..:|....|:....|    :.|.:|...:|
  Rat   315 FTAGLSSELRSVLTMMLEPDPQLRATAE----VLLALPMLRQP 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 84/262 (32%)
Pkinase 50..335 CDD:278497 84/260 (32%)
Pkmyt1NP_001099236.1 PKc_Myt1 99..348 CDD:270952 82/255 (32%)
S_TKc 101..350 CDD:214567 83/255 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.