DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and par-1

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster


Alignment Length:361 Identity:90/361 - (24%)
Similarity:154/361 - (42%) Gaps:84/361 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PDLVETRQYRPQGSSKMD-----------------RYEKLSRLGEGSYGVVYKCRDRETGALVAV 78
            |..::.|....:||..|.                 :|:.:..:|:|::..|...:...||..||:
  Fly   217 PSAIKQRTSSAKGSPNMQMRSSAPMRWRATEEHIGKYKLIKTIGKGNFAKVKLAKHLPTGKEVAI 281

  Fly    79 KRFVESEDDPAIRKIALREIRLLKNLKHPNLVSLLEVFRRKRRLHLVFEFC------ELTVLHEL 137
            |...:::.:|...:...||:|::|.|.|||:|.|.:|...::.|:|:.|:.      :..|||  
  Fly   282 KIIDKTQLNPGSLQKLFREVRIMKMLDHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLH-- 344

  Fly   138 ERHPQGCPEHLTKQICY-QTLLGVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGE 201
                 |..:....::.: |.:..|.|||::..:|||:|.||:||.::..:|:.||||:...:||.
  Fly   345 -----GRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAENLLLDSELNIKIADFGFSNEFTPGS 404

  Fly   202 NYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDL 266
            ....:..:..|.||||..|....|..||||::|.:...||.|.                      
  Fly   405 KLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGS---------------------- 447

  Fly   267 LPRHIQIFGQNEYFKGITLPVPPTLEPLEDKMPAKSQQNPLTI-----DFLKKCLDKDPTKRWSC 326
            ||           |.|      .||..|.:::.....:.|..:     :.|:|.|..:|.||.|.
  Fly   448 LP-----------FDG------STLRELRERVLRGKYRIPFYMSTDCENLLRKFLVLNPAKRASL 495

  Fly   327 EKLTKHSY----FDD-----YIAKQRELEHVNSLEA 353
            |.:....:    |::     ||..:.:|.....:||
  Fly   496 ETIMGDKWMNMGFEEDELKPYIEPKADLADPKRIEA 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 79/319 (25%)
Pkinase 50..335 CDD:278497 79/300 (26%)
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 79/297 (27%)
S_TKc 253..504 CDD:214567 79/296 (27%)
UBA_MARK_Par1 525..563 CDD:270522 2/7 (29%)
MARK1-3_C 839..936 CDD:213381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.