DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and mik1

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_595093.1 Gene:mik1 / 2540885 PomBaseID:SPBC660.14 Length:581 Species:Schizosaccharomyces pombe


Alignment Length:204 Identity:54/204 - (26%)
Similarity:96/204 - (47%) Gaps:22/204 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RYEKLSRLGEGSYGVVYKCR--DRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKH-PNLV 110
            |::::..:.|..:..||...  :..|..:..||...::......::..|:|:.:|:.|:. |.:|
pombe   288 RFQQVKPIHESDFSFVYHVSSINPPTETVYVVKMLKKNAAKFTGKERHLQEVSILQRLQACPFVV 352

  Fly   111 SLLEVFRRKRRLHLVFEFC----------ELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHK 165
            :|:.|:.....:.|..::|          ||.:|..::      |..:.|.: :|....:.:.|.
pombe   353 NLVNVWSYNDNIFLQLDYCENGDLSLFLSELGLLQVMD------PFRVWKML-FQLTQALNFIHL 410

  Fly   166 QGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDV 230
            ...:|.|:||.|:|:|..|.:||.|||.|..| |..:..|....|.|.|||:|... .||.|.||
pombe   411 LEFVHLDVKPSNVLITRDGNLKLGDFGLATSL-PVSSMVDLEGDRVYIAPEILASH-NYGKPADV 473

  Fly   231 WAIGCLFAE 239
            :::|....|
pombe   474 YSLGLSMIE 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 54/204 (26%)
Pkinase 50..335 CDD:278497 53/203 (26%)
mik1NP_595093.1 PTKc_Wee1_fungi 288..556 CDD:270954 54/204 (26%)
S_TKc 300..556 CDD:214567 52/192 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.