DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and cdc2

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001342995.1 Gene:cdc2 / 2539869 PomBaseID:SPBC11B10.09 Length:297 Species:Schizosaccharomyces pombe


Alignment Length:315 Identity:105/315 - (33%)
Similarity:173/315 - (54%) Gaps:42/315 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNL----KHP 107
            |:.|:|:.::|||:||||||.|.:.:|.:||:|:....::...:...|:|||.|||.:    ...
pombe     1 MENYQKVEKIGEGTYGVVYKARHKLSGRIVAMKKIRLEDESEGVPSTAIREISLLKEVNDENNRS 65

  Fly   108 NLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQ----GCPEHLTKQICYQTLLGVAYCHKQGC 168
            |.|.||::...:.:|:|||||.::.:...::|..:    .....|.::..||.:.||.:||.:..
pombe    66 NCVRLLDILHAESKLYLVFEFLDMDLKKYMDRISETGATSLDPRLVQKFTYQLVNGVNFCHSRRI 130

  Fly   169 LHRDIKPENILLTAQGQVKLCDFGFARMLS-PGENYTDYVATRWYRAPELLVGDTQYGTPVDVWA 232
            :|||:||:|:|:..:|.:||.|||.||... |..|||..:.|.||||||:|:|...|.|.||:|:
pombe   131 IHRDLKPQNLLIDKEGNLKLADFGLARSFGVPLRNYTHEIVTLWYRAPEVLLGSRHYSTGVDIWS 195

  Fly   233 IGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPLED- 296
            :||:|||::|...|:||.|::|:::.|.:.||.         ...|.:.|:||        |:| 
pombe   196 VGCIFAEMIRRSPLFPGDSEIDEIFKIFQVLGT---------PNEEVWPGVTL--------LQDY 243

  Fly   297 -------------KMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYFDDY 338
                         |:....:::  .|:.|...|..||..|.|.::..:.:|..|:
pombe   244 KSTFPRWKRMDLHKVVPNGEED--AIELLSAMLVYDPAHRISAKRALQQNYLRDF 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 102/309 (33%)
Pkinase 50..335 CDD:278497 102/307 (33%)
cdc2NP_001342995.1 STKc_CDK1_CdkB_like 4..293 CDD:270829 102/307 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.