DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7236 and CDK20

DIOPT Version :9

Sequence 1:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_016870050.1 Gene:CDK20 / 23552 HGNCID:21420 Length:351 Species:Homo sapiens


Alignment Length:309 Identity:115/309 - (37%)
Similarity:171/309 - (55%) Gaps:36/309 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKI-------ALREIRLLKNL 104
            ||:|..|.|:|||::|:|:|.:..|||.:||:|:.       |:|::       |||||:.|:.:
Human     1 MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKV-------ALRRLEDGFPNQALREIKALQEM 58

  Fly   105 K-HPNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQ-GCPEHLTKQICYQTLLGVAYCHKQG 167
            : :..:|.|..||.......|.|||. |:.|.|:.||.| ...:...|......|.|||:||...
Human    59 EDNQYVVQLKAVFPHGGGFVLAFEFM-LSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANN 122

  Fly   168 CLHRDIKPENILLTAQGQVKLCDFGFARMLSPGEN--YTDYVAT-----RWYRAPELLVGDTQYG 225
            .:|||:||.|:|::|.||:|:.|||.||:.||..:  ||..|||     |||||||||.|..||.
Human   123 IVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATSPLPRRWYRAPELLYGARQYD 187

  Fly   226 TPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLG----DLLPRHIQIFGQNEYFKGITLP 286
            ..||:|::||:..||:.|..|:||::|::||..:.:.||    .:.|...::...|:......:|
Human   188 QGVDLWSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVP 252

  Fly   287 VPPTLEPLEDKMPAKSQQNPLTIDFLKKCLDKDPTKRWSCEKLTKHSYF 335
            :     |||:.:|..|   |..:|.|.:.|...|.:|.:..|...|.||
Human   253 M-----PLEEVLPDVS---PQALDLLGQFLLYPPHQRIAASKALLHQYF 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 112/306 (37%)
Pkinase 50..335 CDD:278497 111/304 (37%)
CDK20XP_016870050.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.